Recombinant Rat ATP-binding cassette sub-family G member 2 (Abcg2)

Code CSB-CF767334RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Abcg2
Uniprot No.
Alternative Names
Abcg2; Bcrp1; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein 1 homolog; Urate exporter; CD antigen CD338
Species
Rattus norvegicus (Rat)
Expression Region
1-657
Target Protein Sequence
MSSSNDHVLVPMSQRNKNGLPGMSSRGARTLAEGDVLSFHHITYRVKVKSGFLVRKTAEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPRGLSGDVLINGAPQPANFKCSS GYVVQDDVVMGTLTVRENLQFSAALRLPKAMKTHEKNERINTIIKELGLDKVADSKVGTQ FTRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLMFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNRGEQDHEANKTEEPSKREKPIIENLAEFYINSTIYGETKAELDQLPVAQKKKG SSAFREPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGALYFGLKNDP TGMQNRAGVFFFLTTNQCFTSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKLVSDLLP MRFLPSVIYTCILYFMLGLKRTVEAFFIMMFTLIMVAYTASSMALAIAAGQSVVSVATLL MTISFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQHNEFLGQEFCPGLNVTMN STCVNSYTICTGNDYLINQGIDLSPWGLWRNHVALACMIIIFLTIAYLKLLFLKKYS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain. It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation.
Gene References into Functions
  1. The ROS-mediated increase in the synthesis of MRP-1 and BCRP can play an important role in hyperoxaluria-promoted calcium oxalate urolithiasis by facilitating phosphatidylserine redistribution in renal epithelial cells. PMID: 28577929
  2. conclusion, MDR1 and BCRP are expressed on apical membranes of the rodent placental SynT-II layer. PMID: 27616577
  3. Parathryoid hormone down-regulates ABCG2 expression on the plasma membrane to suppress intestinal and renal urate excretion in secondary hyperparathyroidism leading to hyperuricemia. PMID: 27988213
  4. Insulin significantly increased URAT1 and decreased ABCG2 levels, resulting in increased kidney tubule uric acid reabsorption in streptozotocin-diabetic rats. PMID: 28679589
  5. unconjugated Bilirubin elevation in Bile Duct Ligated rats impairs the function and expression of breast cancer resistance protein at the Blood-Brain-Barrier, thus contributing to hepatic encephalopathy. PMID: 27180978
  6. olomoucine II, but not purvalanol A placental passage is affected by p-glycoprotein (ABCB1), breast cancer resistance protein (ABCG2) and multidrug resistance-associated proteins (ABCCs). PMID: 26364927
  7. Cilostazol inhibits ABCG2 activity increasing donezapil accumulation in the heart and resulting in cardiotoxicity. PMID: 26467765
  8. Tetronic 904-containing polymeric micelles overcame the overexpression of ABCG2 in the BBB caused by chronic administration of EFV then boosting its penetration into the CNS PMID: 26252052
  9. In 5/6 nephrectomy model of chronic kidney disease rats exhibited lower excretion of urine uric acid and over-expression of ABCG2 in the ileum. PMID: 23584883
  10. Data suggest that, with aging, up-regulation of reactive oxygen species derived from xanthine oxidase down-regulates uric acid excretion via down-regulation of active homodimer Bcrp1/Abcg2 which is uric acid efflux transporter in ileal mucosa. PMID: 26119820
  11. These findings suggest that Bcrp may be involved in the cellular export of select mercuric species PMID: 25868844
  12. Hepatic BCRP expression and function were oppositely regulated in type 1 and type 2 diabetic models. PMID: 24342797
  13. Bcrp is localized to the endothelial TJ barrier in microvessels at the interstitium and also the peritubular myoid cells in the testis, but not at the Sertoli cell BTB. Bcrp regulates the configuration of the actin filament bundles at the apical ES. PMID: 23403943
  14. It may be concluded that BCRP plays an important role in the intestinal efflux of MED-5 and limits the bioavailability after oral administration of MED-15. PMID: 23333829
  15. Impaired hepatic CYP2C11 and intestinal BCRP expression and activity induced by diabetes contributes to the increased exposure of orally administered glibenclamide. PMID: 22393122
  16. Report drug metabolizing phenotype of Bcrp knockout rats. PMID: 22711747
  17. The Abcg2(-/-) rat is a useful model for understanding the role of breast cancer resistance protein in elimination and oral absorption PMID: 22869929
  18. These findings indicate similar Abcg2 transporter expression, function, and regulation at the blood-spinal cord and blood-brain barriers. PMID: 22472606
  19. Butyrate (BT) is a BCRP substrate. It is very important in the context of the high levels of BCRP expression in the human colon and the anticarcinogenic and anti-inflammatory role of BT at that level. PMID: 21775706
  20. It was suggested that the oral absorption of efavirenz is affected by modifications in the ABCG2 intestinal expression contributing to the intra-individual bioavailability variations. PMID: 21803024
  21. Consistent with protein expression data, no changes in diabetic rats occurred, suggesting an unaltered function of brain bcrp. PMID: 21075088
  22. investigation of expression and function of BCRP in rat liver; decreased biliary excretion in some genetically modified rat models may be attributed to decreased BCRP expression PMID: 21106720
  23. Nanomolar concentrations of 17-beta-estradiol (E2) rapidly reduced BCRP1 transport activity in the brain capillaries. PMID: 20216549
  24. Hepatic oval cells express high levels of MDR1, MRP1 and Bcrp1 genes which may have cytoprotective functions during severe hepatotoxicity. PMID: 17669244
  25. These results indicate that hepatic oval cells have a phenotype defined by expression of ATP-binding cassette transporter ABCG2/BCRP1, suggesting that oval cells may represent stem cells in the liver. PMID: 12819005
  26. These results suggest that rat brain capillaries express functional rABCG2 protein and that the transport activity of the protein is up-regulated by astrocyte-derived soluble factor(s) concomitantly with the induction of rABCG2 mRNA PMID: 15255930
  27. Has an important role in extruding glucuronide and sulfate conjugates formed in enterocytes into the intestinal lumen. PMID: 15598971
  28. progesterone plays a role in reduction in the expression level of ABCG2 in the placenta with the advance of gestation from the mid stage to the end of gestation PMID: 16244436
  29. a two-level defensive role of Bcrp in the rat placenta in which the transporter 1) reduces passage of its substrates from mother to fetus but also 2) removes the drug already present in the fetal circulation. PMID: 16809480
  30. Show low endogenous ABCG2 protein expression, localization and activity in cultures of rat brain microvessel endothelial and glial cells. PMID: 17380269
  31. we demonstrate for the first time that ABCG2 is a target of Notch signaling, and as such, constitutes one of the genes in the regulatory network of Notch signaling, involved in the maintenance of stem cells. PMID: 17635990
  32. The rat fetus is protected by Bcrp against potentially detrimental substances from gestational day 15 onwards. PMID: 18450391
  33. Curcumin may be used to enhance drug exposure when the rate-limiting step of drug absorption and/or tissue distribution is impacted by ABCG2. PMID: 18841445

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Highly expressed in brain capillary, kidney and small intestine. Lower expression in heart. Preferentially expressed (at protein level) on the luminal membrane of brain capillaries, in kidney and small intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X