Recombinant Rat Alpha-2C adrenergic receptor (Adra2c)

Code CSB-CF001390RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adra2c; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR
Species
Rattus norvegicus (Rat)
Expression Region
1-458
Target Protein Sequence
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References into Functions
  1. new data suggest that alpha2-adrenoceptors play no major role on any indices of female sexual behavior. PMID: 25218984
  2. the deleterious effect of prenatal malnutrition on neocortical plasticity in the adult progeny is in part consequence of increased neocortical alpha(2C)-adrenoceptor expression PMID: 22892388
  3. In 6-OHDA-lesioned rats, there was no change in alpha2C adrenoceptor expression in the rostral or caudal striatum in which the highest density of alpha2C mRNA is present. PMID: 21562737
  4. In aging, the alpha-2C receptor mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release. PMID: 20691504
  5. During the development of hypertension, adrenal alpha(2) -adrenoceptor inhibitory function is conserved, accompanied by reduced noradrenaline release and unchanged adrenaline release in spontaneously hypertensive rats. PMID: 21518261
  6. Stimulation of adrenergic alpha 2 receptors in the central nucleus of the amygdala attenuates stress-induced reinstatement of nicotine seeking behavior. PMID: 20854830
  7. Results suggest that changes of beta(2)- and alpha(2C)-adrenergic receptors participate in IL-6-mediated processes in the spleen, especially during chronic stress situations. PMID: 20607388
  8. In a chronic spinal cord injury rat model, alpha(2)-ARs gene expression is downregulated in the injured segment, but returns to the normal level above and below the injured segment. PMID: 19000416
  9. intraspinal modulation of the noradrenergic and adrenergic control of the autonomic outflow to the penis by pre- and postsynaptic alpha(2) adrenoceptors. PMID: 12379250
  10. Alpha 2C-adrenergic receptors are present on axon terminals of spinal interneurons, the majority of them forming axo-dendritic synapses, although a small number of axo-axonic synapses are also found. PMID: 12401319
  11. Data indicate that most dorsal horn axons possessing alpha 2C-adrenergic receptors are excitatory, adding further support to the suggestion that they originate principally from spinal interneurons. PMID: 12591145
  12. Alpha 2C-AR terminals are presynaptic to dendrites and somata of lateral spinal nucleus (LSN) neurons and predominantly form asymmetric synapses. PMID: 15207357
  13. alpha(2A)- and alpha(2C)-adrenoceptors play predominant roles in the regulation of cervical resistance on days 18-21. PMID: 19450576

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1