Recombinant Rat Cannabinoid receptor 2 (Cnr2)

Code CSB-CF874146RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cnr2
Uniprot No.
Alternative Names
Cnr2; Cannabinoid receptor 2; CB-2; CB2; rCB2
Species
Rattus norvegicus (Rat)
Expression Region
1-360
Target Protein Sequence
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Gene References into Functions
  1. Study shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells. PMID: 28336953
  2. CB2 receptor stimulation decreased P2Y13 receptor expression via p38MAPK/NF-kappaB signaling PMID: 28899427
  3. results imply that endogenous cannabinoids may modulate the excitability and the output of Retinal Ganglion Cells by differentially suppressing the activity of L- and T-type Calcium channels through activation of CB1Rs and CB2Rs. PMID: 28431968
  4. Study proposes that promotion of microglial M2 polarization through the cAMP/PKA pathway participates in the cannabinoid receptor-2-mediated anti-inflammatory effects after germinal matrix hemorrhage induction. PMID: 27261088
  5. Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID: 27013280
  6. CB2Rs are functionally involved in several dopamine (DA)-related CNS disorders such as Parkinson's disease, depression, anxiety and schizophrenia. PMID: 26833913
  7. CB2 may have anti-fibrogenic effects after intraventricular hemorrhage. CB2 agonist suppressed fibrosis of ventricular system and alleviated hydrocephalus following intraventricular hemorrhage, which is partly mediated by inhibiting TGF-beta1. PMID: 27769788
  8. Results suggest that CB2R activation partially prevents extracellular signal-regulated kinase phosphorylation, which attenuates microglia accumulation in in vitro and in vivo germinal matrix hemorrhage-induced brain injuries PMID: 25963415
  9. This study reveals a novel cellular function of CB2 cannabinoid receptors in the hippocampus and provides insights into how cannabinoid receptor subtypes diversify the roles of cannabinoids in the brain PMID: 25504573
  10. targeting the CB2 receptor may represent a viable target for anti-inflammatory disease modification in Parkinson's disease PMID: 25895887
  11. The results suggested that activating CB2 receptor exerted protective activity against PQ-induced ALI, and it potentially contributed to the suppression of the activation of MAPKs and NF-kappaB pathways. PMID: 24963491
  12. Data suggest that ligand binding to Cnr2 in spleen is important to agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues). PMID: 23711022
  13. CB2 receptors shpw postsynaptic inhibitory effects on urinary bladder contraction PMID: 23081739
  14. The activation CB2 receptor inhibits the intrinsic, mitochondria-mediated apoptotic pathway therough activation PI3k/Akt signaling pathway. PMID: 23711495
  15. the bilateral distribution of the CB2R protein and messenger RNA (mRNA) in rat dorsal root ganglia (DRG) after unilateral peripheral nerve injury PMID: 23657829
  16. cnr2 activation reverses amyloid-induced memory deficits, decreases microglial and astrocyte markers, promotes amyloid clearance, decreases cnr2 upsurge and decreases IL1beta secretion. PMID: 22795792
  17. Data suggest that chronic activation of CB2 (but not CB1) in neurons of the prefrontal cortex enhances expression of serotonin 2A receptor (5-HT2A) and dopamine D2 receptor (D2 receptor) and formation of 5-HT2A/D2 receptor complexes. PMID: 22791651
  18. The cannabinoid 2 receptor plays an important role in the formation of bone cancer pain. PMID: 22490961
  19. With regard to the signaling pathways of CB2/nNOS-mediated neuroprotection, the study showed nNOS-dependent modulation of the expression of anti-oxidative (Hsp70) and anti-apoptotic (Bcl-2) proteins. PMID: 22198001
  20. CB(2)Rs are located intracellularly in layer II/III pyramidal cells of the rodent medial prefrontal cortex. Their activation results in IP(3)R-dependent opening of Ca(2+)-activated Cl(-) channels. PMID: 22331871
  21. CB2 receptors contribute to the delayed neuroprotective effect whereas CB1 receptor to the rapid ischemic tolerance induced by electroacupuncture pretreatment against focal cerebral ischemia. PMID: 21443454
  22. Data show that MDMA produces changes in IL-1 signal modulators which are modified by CB2 receptor activation, and indicate that IL-1beta may play a partial role in MDMA-induced neurotoxicity. PMID: 21595923
  23. Brain CB2 receptors do not appear to mediate the hypothermic response to bacterial lipopolysaccharide. PMID: 21486787
  24. This study showed that CB2 receptor is localized in retinal pigmentary epithelium, inner photoreceptor segments, horizontal and amacrine cells, cells localized in ganglion cell layer, and in fibers of inner plexiform layer PMID: 20803619
  25. This finding provides new evidence showing the potential role of CB2 receptors in the analgesic effect of acupuncture on inflammatory pain PMID: 20627823
  26. study examined ovary for presence of CB(1) and CB(2) receptors and fatty acid amide hydrolase; in preantral and antral follicles, CB(2) receptor was detected only in oocytes; in functional corpus luteum, it was detected in the luteal cells PMID: 20665820
  27. CBR2 receptors mediate anandamide-induced inhibitory action on the activation of hepatic stellate cells. PMID: 18578993
  28. levels of the cannabinoid receptor type 2 in cells of macrophage lineage undergo major modulatory changes in relation to cell activation PMID: 11789671
  29. The rat peripheral cannabinoid receptor (rCB2) was cloned from a Sprague-Dawley rat spleen cDNA library and when translated, encodes a protein of 410 amino acids. PMID: 12084572
  30. Induction of CB2 receptor expression in the rat spinal cord of neuropathic but not inflammatory chronic pain models. PMID: 12823482
  31. Review discusses the possibility that CB2 receptors in the rat intestine could contribute to reducing the increase of intestinal motility induced by an endotoxic inflammation. PMID: 15277313
  32. activation of cannabinoid CB2 receptors is sufficient to suppress neuronal activity at central levels of processing in the spinal dorsal horn PMID: 15317842
  33. This study demonstrates that activation of peripheral CB2 receptors attenuates both innocuous- and noxious-evoked responses of WDR neurons in models of acute, inflammatory and neuropathic pain. PMID: 15525273
  34. Cannabinoids abrogate microglia-mediated neurotoxicity after betaA addition to rat cortical cocultures indicating a role for cannabinoid receptors in preventing neurodegeneration.CB2 receptors appear to be exclusively expressed by microglia. PMID: 15728830
  35. Our results suggest that the role of CB2 receptors in the brain may have been previously underestimated. PMID: 16356641
  36. The multifocal expression of CB2 immunoreactivity in glial and neuronal patterns in a number of brain regions suggests reevaluation of the possible roles that CB2 receptors may play in the brain. PMID: 16472786
  37. involvement of the cyclic AMP-protein kinase A-Cyclic AMP response element pathway in the regulation of CB(2) receptor levels PMID: 17045344
  38. CB2 cannabinoid receptors and their gene transcripts are widely distributed in the brain and may play broader roles. PMID: 17356307
  39. endocannabinoid system modulates glucose homeostasis through the coordinated actions of cannabinoid CB1 and CB2 receptors. PMID: 17499236
  40. The results of this study suggest that endogenous cannabinoids, through acting on cannabinoid CB(2) receptors, are involved in the cardioprotective phenomenon of remote ischemic preconditioning, induced by mesenteric artery occlusion and reperfusion PMID: 17950273
  41. We conclude WIN inhibits the neurotransmission in the NTS of young rats via a receptor distinct from CB1 or CB2. PMID: 18308297
  42. It was concluded that activation of CB2 receptors in the enteric nervous system dampens endotoxin-induced enhanced intestinal contractility. PMID: 18483180
  43. Subcellular distribution of CB2 cannabinoid receptors is demonstrated in neuronal, glial, and endothelial cells in rat hippocampus with immunohistochemical electron microscopy. PMID: 18798269
  44. Data demonstrate the functional expression of CB2 receptors in the brain that may provide novel targets for the effects of cannabinoids in depression and substance abuse disorders beyond neuroimmunocannabinoid activity. PMID: 18991891
  45. Results provide ultrastructural evidence that CB2 receptors are mainly postsynaptic in the CA1 area of the hippocampus and substantia nigra. PMID: 18991892
  46. CB2R activation counteracts apoptotic cell death that is induced by remote axonal damage by acting through phosphatidylinositol 3-kinase/Akt signaling. PMID: 19357281
  47. cellular microglial pathway triggered by CBR2 activation; reduction of pro-inflammatory factors and microglial migration via MKP-3 induction is part of the mechanism of action of CBR2 agonists PMID: 19476641
  48. To date, it has been thought that cannabinoid receptors in CNS are primarily of the CB1R subtype, with CB2R expressed only in glia and peripheral tissues. However, these data provide pharmacological evidence for functional CB2R at CNS synapses. PMID: 19616018

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon. Note=Localizes to apical dendrite of pyramidal neurons.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in spleen and brain by neurons and glial cells (at protein level). Expressed in lung, testis and thymus but not in heart, liver or kidney. Expressed in cerebellum, cortex and brainstem.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1