Recombinant Rat Cortexin-1(Ctxn1)

Code CSB-CF006210RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41237
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MSAPWTLSPEPLPPSTGPPVGAGLDVEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRM PASSWTDHKEALERGQFDYALV
Source in vitro E.coli expression system
Gene Names Ctxn1
Protein Names Recommended name: Cortexin-1
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate extracellular or intracellular signaling of cortical neurons during forebrain development.
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Cortexin family
Tissue Specificity Neuron specific.
Database Links

KEGG: rno:29145

UniGene: Rn.9131

Related Products

Ctxn1 Proteins

Ctxn1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.