Recombinant Rat G-protein coupled bile acid receptor 1 (Gpbar1)

Code CSB-CF767305RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Gpbar1; Tgr5; G-protein coupled bile acid receptor 1; Membrane-type receptor for bile acids; M-BAR
Species
Rattus norvegicus (Rat)
Expression Region
1-329
Target Protein Sequence
MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAG LLTGLALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPH GSVRLALFLTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGAT ALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYV ATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQV LRGRPKRANPGPSTAYHSSSQCSTDLDLN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. Involved in bile acid promoted GLP1R secretion.
Gene References into Functions
  1. contributes to hepatic cystogenesis by increasing cAMP and enhancing cholangiocyte proliferation PMID: 28543567
  2. GPBAR1/TGR5 receptor agonist, tauroursodeoxycholic acid, has anti-inflammatory effects in microglial cells. PMID: 27987324
  3. bile acids promote intestinal epithelial cell proliferation and decrease mucosal injury by upregulating TGR5 expression in obstructive jaundice. PMID: 28034761
  4. We conclude that increased levels of circulatory bile acids induced by high-fat feeding upregulate nNOS and TGR5 expression in the gastric myenteric plexus, resulting in enhanced NANC relaxation and delayed gastric emptying. PMID: 25540233
  5. Data suggest that Tgr5 is expressed in two cell types of term placenta, macrophages and trophoblasts; Tgr5 mRNA abundance in placenta markedly increases during the last week of pregnancy in control but not in model of maternal cholestasis. PMID: 23849932
  6. A new role is demonstrated for TGR5 on epithelial cells, where the bile acid receptor regulates colonic fluid and electrolyte transport, decreases basal secretory tone and inhibits cholinergic-induced secretory responses. PMID: 23634890
  7. TGR5 is implicated in the suppression of macrophage functions by bile acids PMID: 12524422
  8. This is the first report on the expression of TGR5 in sinusoidal endothelial cells. Regulation of eNOS by TGR5 connects bile salts with hepatic hemodynamics. PMID: 17326144
  9. TGR5 is localized in the plasma membrane of isolated Kupffer cells and is responsive to bile acids;it may play a protective role in obstructive cholestasis preventing excessive cytokine production thereby reducing liver injury. PMID: 18468513

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

KEGG: rno:338443

UniGene: Rn.41687

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×