Recombinant Rat G-protein coupled estrogen receptor 1(Gper)

Code CSB-CF009713RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O08878
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALF LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLD EQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGL IWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRA LIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRH AYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVI PDSTEQSDVKFSSAV
Source in vitro E.coli expression system
Gene Names Gper1
Protein Names Recommended name: G-protein coupled estrogen receptor 1 Alternative name(s): Chemoattractant receptor-like 2 G-protein coupled receptor 30 G-protein coupled receptor 41 Membrane estrogen receptor Short name= mER
Expression Region 1-375
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA-induced excitotoxic neuronal death. Increases firing activity and intracellular calcium oscillations in luteinizing hormone-releasing hormone (LHRH) neurons. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells.
Subcellular Location Nucleus, Cytoplasm, perinuclear region, Cytoplasm, Cytoplasm, cytoskeleton, Cytoplasmic vesicle membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Basolateral cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Early endosome, Recycling endosome, Golgi apparatus, trans-Golgi network, Golgi apparatus membrane, Multi-pass membrane protein, Cell projection, dendrite, Cell projection, dendritic spine membrane, Multi-pass membrane protein, Cell projection, axon, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density, Mitochondrion membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the brain. Expressed in neurons of the hippocampus, hypothalamic paraventricular nucleus (PVN), supraoptic nucleus (SON) and the median eminence. Expressed in magnocellular neurosecretory cells (MNCs) which secrete oxytocin but not in MNCs wh
Database Links

KEGG: rno:171104

STRING: 10116.ENSRNOP00000001732

UniGene: Rn.9806

Pathway Estrogen signaling pathway

Related Products

Gper1 Proteins

Gper1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.