Recombinant Rat Gap junction beta-1 protein (Gjb1)

Code CSB-CF009451RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gjb1
Uniprot No.
Alternative Names
Gjb1; Cxn-32; Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein
Species
Rattus norvegicus (Rat)
Expression Region
1-283
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. these results highlight the role of post translational modifications and lysines in the C-terminal tail of Cx32 in the fine-tuning of Cx32 protein stability and channel-independent functions. PMID: 30268116
  2. In vitro gain and loss of function analyses showed overexpression of Connexin 32 and knockdown of Connexin 43 promoted hepatocytes differentiation from hepatic progenitor cells. PMID: 29116012
  3. retrograde influences originating from the peripheral injury site elicit dramatic changes in the central nervous system expression of Connexin 32, which in turn may mediate the plasticity of oligodendrocyte lineage cells observed in the spinal cord following peripheral axon injury. PMID: 27246301
  4. Connexin 32 dysfunction promotes ethanol-related hepatocarcinogenesis via activation of Dusp1-Erk axis. PMID: 26655499
  5. Cx 32 and Cx 43 associated with oligodendrocytes and astrocytes had an important role in the first stages of seizures induced by 4-AP, whereas Cx36 localized to neurons could be associated with later stages. PMID: 26268619
  6. Cx32 and luteolin have suppressive roles in inflammation, fibrosis and hepatocarcinogenesis during non-alcoholic steatohepatitis progression. PMID: 26494227
  7. Modulating gap junction by Cx32 gene silencing protected BRL-3A liver cells from hypoxia/reoxygenation injury. PMID: 25530438
  8. Tryptophan was substituted for residues in all four transmembrane domains of connexin32. Tryptophan substitution was poorly tolerated in all domains, with the greatest impact in TM1 and TM4. PMID: 25969535
  9. Studies have shown connexin32 expression increases when liver or brain damage becomes more serious and these damages can be blocked by Cx32 inhibitors through decreasing oxidative stress and cell apoptosis. PMID: 25254904
  10. Low extracellular pH can regulate pancreatic acinar cell gap junctional intercellular communication by enhancing connexin32 degradation. PMID: 24812055
  11. Cx32 gap junction communication in the hippocampus does not contribute to kindling epileptogenesis PMID: 23149765
  12. Transcriptional overexpression of hippocampal Cx30 and Cx32 could be an adaptive response to production of intracellular toxic molecules but it is not accompanied with post- transcriptional overexpression and might have no functional impact. PMID: 23023213
  13. connexin32 hemichannels facilitate the apoptotic-to-necrotic transition, which typically occurs in the final stage of hepatocellular apoptosis PMID: 19960225
  14. Data show that connexins are differentially expressed in rat gray matter: Cx26, Cx30 and Cx43 were found only in astrocyte gap junctions; Cx32 was only in oligodendrocytes, and Cx36 was only in neurons. PMID: 12064610
  15. role of Cx32 in forming channels permeable to adenosine, AMP, ADP, ATP PMID: 12119284
  16. analysis of functional regulatory regions of the connexin32 gene promoter PMID: 12850269
  17. In the current experiments, immunoblot and immunohistochemical protocols were used to investigate the regional distribution and cellular localization of Cx36 in putative CO2-chemosensitive brainstem regions in both neonatal and adult rats. PMID: 14637306
  18. In livers of transgenic rats, membrane localization of normal endogenous connexin 32 protein is disturbed, and gap junction capacity is markedly decreased. Fewer liver cells were damaged and serum enzyme elevation was much lower in transgenic rats. PMID: 15239104
  19. Cx32 is downregulated by the ILK pathway activation in rat hepatocytes and this is mediated via the activation and nuclear translocation of Akt PMID: 16679308
  20. connexin 32 and 43 have roles in formation of functional gap junctions in neurite outgrowth PMID: 16731531
  21. a cross-talk between CFTR and a variety of gap junction channels. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins are likely to play a role in CFTR-connexins interaction. PMID: 17546509
  22. magnitude of cell proliferation was inversely proportional to level of cx32 expression in a hepatoma cell line; inverse relationship between Cx32 expression & proliferation was continuous PMID: 18809458
  23. Cx43 and Cx32 undergo a multistep conformational maturation process in which folding of connexin monomers within the endoplasmic reticulum is a prerequisite for multisubunit assembly in the trans-Golgi network. PMID: 19297523

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Beta-type (group I) subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X