Recombinant Rat Gastrin-releasing peptide receptor(Grpr)

Code CSB-CF009943RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P52500
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MDPNNCSHLNLEVDPFLSCNNTFNQTLSPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNI TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQ SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML HFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMT SFKSTNPSATFSLINGNICHEGYV
Source in vitro E.coli expression system
Gene Names Grpr
Protein Names Recommended name: Gastrin-releasing peptide receptor Short name= GRP-R Alternative name(s): GRP-preferring bombesin receptor
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for gastrin-releasing peptide (GRP)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: rno:24938

STRING: 10116.ENSRNOP00000005559

UniGene: Rn.10316

Pathway Calcium signaling pathway

Related Products

Grpr Proteins

Grpr Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.