Recombinant Rat Histamine H2 receptor (Hrh2)

Code CSB-CF010738RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hrh2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Species
Rattus norvegicus (Rat)
Expression Region
1-358
Target Protein Sequence
MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. the histaminergic afferent inputs in the striatum may modulate both dopamine D1 and D2 receptor-expressing medium spiny projection neurons by activation of postsynaptic histamine H1 and H2 receptors. PMID: 29498008
  2. findings indicate that histamine H1, H2, and H3 receptors are present in rat olfactory epithelium and may play a physiological role in olfactory transmission. PMID: 28964277
  3. Isolated rat mesenteric collecting lymphatics were treated with 1- to 100-muM histamine. Pharmacologic blockade of either H1 or H2 histamine receptors significantly inhibited the response to histamine. PMID: 24702851
  4. Na+-Ca2+ exchangers coupled to H1 receptors and hyperpolarization-activated cyclic nucleotide-gated channels linked to H2 receptors co-mediate the strong postsynaptic excitatory action of histamine on al vestibular nucleus neurons PMID: 23713466
  5. Histamine H2 receptors, unlike the H1 receptor type, do not mediate emotional memory consolidation impairment. PMID: 22986235
  6. Data suggest histamine stimulates proliferation of Leydig tumor cells via activation of HRH2 and a transient increase in intracellular cAMP levels. Normal/immature Leydig cells and progenitor Leydig cells exhibit very low levels of HDC expression. PMID: 23077168
  7. Data suggest that histamine facilitates consolidation of fear extinction through mechanism involving Hrh2-dependent phosphorylation of ERK1 in hippocampus. PMID: 21211106
  8. at the level of the hippocampus, histamine through its H1 and H2 receptors, mediates orofacial region pain PMID: 21602597
  9. H1, H2, and H3 histamine receptor mRNA detected in modiolus but not in lateral and medial portions of the cochlea. First evidence of H1, H2, and H3 histamine receptor mRNA in rat cochlea. PMID: 12634496
  10. Postischemic iecrease in H(2) receptor binding densities in the caudate-putamen. PMID: 16181737
  11. endogenous histamine might be involved in the recruitment of neutrophils and protein leaks in LPS-induced acute lung injury via the H2 receptors PMID: 16858644
  12. Data show that famotidine, a H2 receptor antagonist, decreases the late phase of orthodontic tooth movement in rats. PMID: 18345502

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1