Recombinant Rat Melanocortin receptor 3 (Mc3r)

Code CSB-CF013560RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Mc3r
Uniprot No.
Alternative Names
Mc3r; Melanocortin receptor 3; MC3-R
Species
Rattus norvegicus (Rat)
Expression Region
1-323
Target Protein Sequence
MNSSCCPSSSYPTLPNLSQHPAAPSASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI LAVVRNGNLHSPMYFFLLSLLQADMLVSLSNSLETIMIVVINSDSLTLEDQFIQHMDNIF DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALSLIVAIWVCCGICGVMFI VYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAALPPADGVAPQQHSCMKG AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA FRSLELRNTFKEILCGCNGMNVG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain.
Gene References into Functions
  1. Study demonstrates an arcuate nucleus of the hypothalamus pro-opiomelanocortinergic projection onto ventral tegmental area dopaminergic neurons that modulates motivation for palatable food via activation of melanocortin 3 receptor signaling. PMID: 26852738
  2. Compared with low-activity rats, high-activity rats show enhanced mRNA expression of MCRs in the brain, specifically of MC3R in the paraventricular nucleus. PMID: 22643233
  3. These results show that immunization against the melanocortin-3 receptor resulted in the production of Abs with positive or negative allosteric properties. PMID: 21091037
  4. Identification of domains directing specificity of coupling to G-proteins PMID: 12045190
  5. role for PKC isozymes in gamma-2-MSH/MC3-R receptor signaling and in neuronal cell differentiation. PMID: 12906838
  6. Melanocortin MC3 receptor expression is detected in adult retina and superior colliculus. Following optic nerve transection expresssion is increased in retina and decreased in superior colliculus. PMID: 14660008
  7. MC3-R is not involved in leptin-stimulated or spontaneous growth hormone secretion PMID: 14688446
  8. These results suggest that the MC3-R is not involved in mediating the potentiation effect, adding further evidence to the argument that another melanocortin receptor exists. PMID: 15666803
  9. Efforts revealed a sequence consistent with that predicted by the rat genome, but different from the published receptor by three amino acids, all of which were located in the predicted second transmembrane domain. PMID: 15985309
  10. These data show that MC3-R is expressed in rat IMCD cells in a manner modulated by dietary sodium intake. PMID: 16195498
  11. Using a transgenic and pharmacological approach, we provide strong proof of concept for the development of selective MC3-R agonists as novel anti-inflammatory therapeutics. PMID: 17077300
  12. analysis of activation and endocytic internalization of melanocortin 3 receptor in neuronal cells PMID: 17405938
  13. Expression levels of melanocortin 3 receptor (MC3R) and melanocortin 5 receptor (MC5R) were not significantly affected by high dietary salt intake in either WKY or SP-SHR tissues. PMID: 17531155
  14. weight gain does not raise arterial pressure in the absence of a functional MC3/4 receptors in hypertension PMID: 18285617

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1