Recombinant Rat Melanocortin receptor 4 (Mc4r)

Code CSB-CF013561RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Mc4r
Uniprot No.
Alternative Names
Mc4r; Melanocortin receptor 4; MC4-R
Species
Rattus norvegicus (Rat)
Expression Region
1-332
Target Protein Sequence
MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS GVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL IYALRSQELRKTFKEIICFYPLGGICELPGRY
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. Plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Gene References into Functions
  1. MC3R deficiency caused a reduction of food intake and body weight, whereas at the same time exhibited additive effects on top of MC4R deficiency on lipid and glucose metabolism. PMID: 27713523
  2. Thus study demonstrated that Adolescent Alcohol Exposure-Induced Changes in melanocortin 4 receptor. PMID: 28575455
  3. results revealed that MC4R activation was able to attenuate oxidative stress and mitochondrial dysfunction in skeletal muscle induced by diabetes partially through activating the AMPK-SIRT1-PGC-1alpha signaling pathway. PMID: 28409883
  4. Although MC4R obese pregnant rats had elevated blood pressure associated with reduced total NOS activity and expression, they had enhanced NOS-mediated attenuation of vasoconstriction, with no evidence of alterations in NOS-mediated regulation of blood pressure. PMID: 27534879
  5. MC4R is predominantly expressed in hepatocytes and upregulated during rat liver regeneration after hepatectomy. PMID: 24433867
  6. A synthetic peptide corresponding to cytoplasmic loop 1 of MC4R suppresses basal adenylate cyclase activity and basal level of GppNHp binding of heterotrimeric G proteins produced by THIQ and alpha-MSH in synaptosomal membranes of rat brain. PMID: 26593415
  7. Results suggest that the anti-inflammatory effects of MC4 receptor agonists may not be sufficient to prevent tinnitus. PMID: 25977231
  8. These results suggest that although hindbrain MC4R activity contributes to appetite and heart rate regulation, it does not play a major role in mediating the elevated blood pressue in spontaneously hypertensive rats. PMID: 25668357
  9. Nesfatin-1 suppresses L-type Ca2+ channels via the MC4-R that couples sequentially to the betagamma subunits of Gi/o-protein and the novel PKC theta isoform in adult ventricular myocytes. PMID: 25997563
  10. MC4 receptors play a critical role in stress-induced reinstatement of nicotine seeking, but these receptors may not play a role in the dysphoria associated with acute nicotine withdrawal. PMID: 24612112
  11. The alpha-MSH-MC4R system in the posterior ventral tegmental area might be a part of the neuroadaptive mechanism underlying ethanol addiction. PMID: 24635847
  12. proopiomelanocortin derivatives acting via the central MC4 receptor participate in the resuscitative effects of 8-OH-DPAT PMID: 25371525
  13. These data suggest that increases in arterial pressure with chronic hyperandrogenemia in female rats are due, in part, to activation of the sympathetic nervous system, renal nerves, and MC4R. PMID: 25695289
  14. These results support the hypothesis that endogenous MC4R signaling contributes to the HPA axis response to stress. PMID: 24636506
  15. The data of this study demonstrated that MC4R signaling is not required for weight loss following treatment with an Angiotensin-converting enzyme inhibitor. PMID: 23416175
  16. We showed that the melanocortin-3/4 receptor antagonist SHU 9119 attenuates the food intake-suppressive effect of aminoprocalcitonin. PMID: 23571710
  17. These results indicated that activation of MC4Rs in the right IML elicited tachycardia and one of the sources of melanocortins in the IML is the ARCN. PMID: 23832700
  18. our novel findings show that activation of MC4-Rs in the brainstem modulates gastric activity, which may have physiological relevance for food intake and gastric function PMID: 23946387
  19. Melanocortin-4 receptor signalling in the medial amygdala mediates the behavioral and endocrine response to stress. PMID: 22176700
  20. Results indicate that activation of MC3/4Rs in the paraventricular nucleus increases the sympathetic outflow and blood pressure via the cAMP-protein kinase A pathway. PMID: 22872662
  21. Compared with low-activity rats, high-activity rats show enhanced mRNA expression of MCRs in the brain, specifically of MC3R in the paraventricular nucleus, and MC4R and MC5R in the perifornical lateral hypothalamus. PMID: 22643233
  22. This research suggests that activation of MC4R in PAG after peripheral nerve injury participates in pain facilitation by regulating the glial activation and inflammatory cytokines secretion. PMID: 22889616
  23. Data from heterozygote/homozygote rats for Mc4r mutation suggest that Mc4r has role in development of obesity, but Mc4r does not have a role in weight loss or glucose metabolism/glucose intolerance following bariatric vertical sleeve gastrectomy. PMID: 22535749
  24. Long-Evans rats maintained on chow or a high-fat diet (HFD) for 6 weeks. From a total of 19 genes analyzed, seven genes (ETV5, FTO, GNPDA2, KCTD15, TMEM18, MC4R, and SH2B1) were down-regulated in the hypothalamus of HFD compared to chow-fed rats PMID: 21779089
  25. GLP-1 and leptin cooperatively reduce feeding at least in part via inhibition of AMPK following binding of alpha-MSH to MC4-R. PMID: 22390932
  26. melanocortin 4 receptor activation in astrocytes induces brain-derived neurotrophic factor expression through cyclic AMP-protein kinase A-CAMP response element binding proteins pathway without involving nuclear factor kappa B PMID: 21803120
  27. Protein kinase C-lambda gene knockdown modulates hypothalamic glutathione peroxidase, melanocortin receptor and neuropeptide Y gene expression in amphetamine-treated rats. PMID: 20817751
  28. Distribution of MC4-R is consistent with the proposed roles of MC4-R-positive neurons and provides further information about the circuitry controlling food intake, energy balance and sexual responses in both males and females. PMID: 20884347
  29. data suggest biological role for Mc4r in pancreatic (autonomic) neurons in modulating serum insulin; Mc4r (as well as Mc3r & Mc5r; but not Mc1r) is expressed in pancreas of Zucker rats; Mc4r is expressed in hypothalamus of Zucker rats PMID: 20963574
  30. painful neuropathy resulted in the up-regulation of MC4 receptors in the spinal and peripheral nociceptive pathways. This up-regulation of MC4 receptors promotes the pronociceptive action of their endogenous ligands PMID: 20081244
  31. Data are consistent with the view that energetic and feeding responses are not controlled by regionally divergent MC3/4Rs and can be elicited from multiple, anatomically distributed MC3/4R populations. PMID: 19854868
  32. differential roles for the MC3 and MC4 receptors in TRH release; MC3-R agonism inhibiting and MC4-R agonism stimulating TRH release. PMID: 11963824
  33. The distribution of MC4-R mRNA is consistent with the proposed roles of central melanocortin systems in feeding and autonomic regulation. PMID: 12541307
  34. stimulation of the MC4-R, but not the MC3-R, significantly elevated PRL levels in the fasted rats PMID: 12675910
  35. Activation of melanocortin 4 receptors inhibits fever PMID: 12736185
  36. The expression of the MC4-R in cardiorespiratory, musculoskeletal, and integumentary systems supports functional roles for the MC4-R in addition to its roles in appetite, weight control, and regulation of linear growth. PMID: 12959974
  37. Independent caudal brainstem Mc3r/Mc4r trigger for sympathetically stimulated elevation in brown adipose tissue UCP-1 gene expression. Melanotan-II induced rise in UCP-1 expression can be mediated by caudal brainstem and spinal cord. PMID: 12960080
  38. Anorectic actions of prolactin-releasing peptide are mediated by central CRH receptors but not by melanocortin receptors-3/4. Prolactin-releasing peptide can modify Vo2. PMID: 14512273
  39. Melanocortin MC4 receptor mRNA expression in retina and superior colliculus is decreased in superior colliculus after optic nerve transection, but the expression was unchanged or even increased in the retina. PMID: 14660008
  40. neither MC4-R nor MC3-R is involved in leptin-stimulated or spontaneous growth hormone secretion, or at least that the level of MC4-R involvement in GH secretion is much lower than that in luteinizing hormone and prolactin release regulation. PMID: 14688446
  41. MC4R adaptation in dorsal root ganglia observed in neuropathic rats indicates their important role in presynaptic modulation of activity of the primary afferents in neuropathic pain. PMID: 15026153
  42. MC3/4-R antagonism completely blocked the chronic cardiovascular, satiety, and metabolic effects of leptin, suggesting that the hypothalamic melanocortin system plays an important role in mediating these actions of leptin. PMID: 15123576
  43. The effects of electrical foot shock stress on the melanocortin signaling cascade and the hypothalamus-pituitary-adrenal (HPA) system expression in rats of CRF, POMC, and MC4R. PMID: 15585943
  44. UCP-1, Mc4R and CART gene expression are increased as an immediate consequence of consuming high energy diet, and may be involved in countering hypercaloric intake. PMID: 15720470
  45. alpha-MSH, through central MC4-R can modulate the anxiety-like behavior induced by IL-1beta PMID: 16325304
  46. Metabolic and cardiovascular actions of chronic MC3/4-R activation are preserved in diet-induced obesity, supporting potential role for hypothalamic melanocortin system in obesity hypertension. PMID: 16380516
  47. Alpha-MSH, through MC4R activation, attenuates LPS/IFN-gamma-induced inflammation by decreasing iNOS and COX-2 expression and prevents LPS/IFN-gamma-induced apoptosis of astrocytes by modulating the expression of proteins of Bcl-2 family. PMID: 17595227
  48. melanocortin system contributes to the maintenance of adrenergic tone and elevated arterial pressure in SHR rat even though mRNA levels for POMC and MC4R in the mediobasal hypothalamus were not increased compared to WKY rat PMID: 18285617
  49. MC4R signaling leads mainly to presynaptic modulation of glutamatergic synaptic transmission. Melanocortinergic-induced decrease of food intake may occur via enhancement of vagal afferent satiation signals from gastrointestinal tract. PMID: 18463249
  50. Adeno-associated virus-mediated silencing of MC4R on paraventricular nucleus promotes hyperphagia and obesity in response to the dietary challenge in the adult animal. PMID: 18492813

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain, enriched in the striatum, nucleus accumbens, and periaqueductal gray.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X