Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Code CSB-CF005384RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Chrm4; Chrm-4; Muscarinic acetylcholine receptor M4
Species
Rattus norvegicus (Rat)
Expression Region
1-478
Target Protein Sequence
MXNFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLGCADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSA TQNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVP ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL VNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.
Gene References into Functions
  1. M1 and M4 muscarinic receptors are involved in shock-limiting and shock-activating processes, respectively, on the course of posthemorrhagic abnormalities in systemic and hepatic portal circulation. PMID: 22803069
  2. Muscarinic receptor expression is developmentally regulated; M1, M3, and M4 receptors were the main subtypes expressed in oligodendrocyte progenitor cells. PMID: 21913336
  3. M4 muscarinic acetylcholine receptors are up-regulated in dorsal root ganglion neurons and may account for increased muscarinic analgesic effects in a diabetic neuropathic pain model. PMID: 21883220
  4. CaMKII binds and phosphorylates M4 upon Ca2thorn influx to augment the antagonistic action of M4 on D1 signalling and on D1-mediated, cocaine-triggered hyperlocomotion. PMID: 20551968
  5. In a Ca(2+)-sensitive manner, CaMKIIalpha regulates M4 receptor efficacy and controls the acetylcholine-dopamine balance in the basal ganglia and also the dynamics of movement. PMID: 20461055
  6. novel role for M4 (Chrm4) in the regulation of protein synthesis through its interaction with eEF1A2. PMID: 12048193
  7. The m1-m5 muscarinic subtypes mapped to the following chromosomes: Chrm1, chromosome 1; Chrm2, chromosome 4; Chrm3, chromosome 17; Chrm4, chromosome 3; and Chrm5, chromosome 3. PMID: 12433399
  8. There is a significant reduction in the level of muscarinic M4 receptors in the spinal cord of acute and chronic arthritic rats compared to controls, suggesting that the M4 receptor subtype may be involved in cholinergic mechanisms of analgesia. PMID: 12915263
  9. These results suggest that a diet high in n-6 PUFA, but not of n-3 PUFAs or saturated fat, may selectively alter M2/M4 receptor-mediated signal transduction in the rat brain. PMID: 15927789
  10. Transient forebrain ischemia leads to dynamic alterations in the gene expression, protein prevalence, and functionality of muscarinic receptors in the post-ischemic hippocampus at times preceding the degeneration of the vulnerable neurons. PMID: 15951192
  11. evidence presented that stimulation of the muscarinic M4 receptor activates the pro-survival PI3K/Akt pathway to induce tuberin phosphorylation PMID: 15979279
  12. Data show that M1 muscarinic receptors contribute to, whereas M4 receptors inhibit, dopamine D1 receptor-induced [3H]-cyclic AMP accumulation in rat striatal slices. PMID: 16758365
  13. M4-type muscarinic receptors do not support behavioral flexibility. PMID: 17709264
  14. No m4-immunolabeling was detected in the rostral part of the thalamus. PMID: 17845913
  15. investigation of participation of M(4) receptors in neurotransmission at the hippocampal Schaffer collaterals-CA1 synapses; findings support permissive role of M(4) receptors & suggest their necessary participation in synaptic plasticity at these synapses PMID: 18816796
  16. Receptor, Muscarinic M4 activated mTOR protein and its downstream molecule Ribosomal Protein S6 Kinases (70-kDa) in a 1-Phosphatidylinositol 3-Kinase-dependent manner. PMID: 19070673

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM4 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1