Recombinant Rat Neuromedin-K receptor (Tacr3)

Code CSB-CF023070RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Tacr3
Uniprot No.
Alternative Names
Tacr3; Tac3r; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Species
Rattus norvegicus (Rat)
Expression Region
1-452
Target Protein Sequence
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
Gene References into Functions
  1. The different impacts of diverse long-term exercise intensities on the male pituitary-gonadal axis maybe relay by the various changes in hypothalamic Nkb and Pdyn gene expressions. PMID: 30207304
  2. Results give support to the involvement of NK3 receptors in the anxiogenic-like actions of SP6-11(C-terminal), where this metabolite seems to behave as an antagonist, in a way similar to SR142801. PMID: 26851555
  3. Median preoptic nucleus NK3R neurons facilitate cutaneous vasodilation, an important heat-dissipation effector. PMID: 25825817
  4. data suggest that endogenous NeuroKinin B-Neurokinin 3 Receptor signalling plays a role in controlling the timing of puberty. PMID: 24863620
  5. Data indicate that the suppression of the GnRH pulse generator by acute systemic stress equires hypothalamic NKB/neurokinin B (NKB) receptor (NK3R) signaling. PMID: 24708241
  6. evidence that the neurokinin3 receptors (NK3-R) and their influence on acetylcholine release may represent a crucial mechanism that underlies age-related deficits in learning and memory PMID: 23983264
  7. Activation of the NK3R appears to recruit multiple pathways, including acetylation, and possibly histone deactylases, histone methylases, or DNA methylases to affect chromatin structure and gene expression. PMID: 22985858
  8. data provide unique evidence that KNDy neurons promote cutaneous vasodilatation and participate in the E(2) modulation of body temperature PMID: 23150555
  9. Nkr3 peptide may exacerbate 6-OHDA toxicity in an in-vivo model, by modulation of N-methyl-D-aspartate receptor (Grin)1 subunit and c-Jun N-terminal kinase (JNK) pathway activities. PMID: 22762252
  10. Since NK3-R is widely distributed in the CNS, the presence of NK3-R in nuclei from multiple brain regions suggests that it may broadly influence CNS gene expression in a ligand-dependent manner. PMID: 21939739
  11. In response to hyperosmolarity, NK3R is transported to the nucleus of paraventricular hypothalamic neurons and associates with acetylated histone H3 and H4. PMID: 21697521
  12. Data suggest that NKB/NK3R signaling in kisspeptin+ neurons in the arcuate nucleus plays a pivotal role in control of GnRH/LH secretion. NKB and NK3R mRNAs are widely expressed in the central forebrain. PMID: 21045176
  13. In response to acute hyperosmotic challenge, NK3R associates with importin ss-1 which enables the nuclear transport of NK3R. PMID: 20709160
  14. heterologous and homologous desensitization of NK3-R-mediated contractility is dependent upon the duration of exposure to estrogen PMID: 12390879
  15. NK3 receptors had a distinct distribution in the caudal half of the solitary nucleus, suggesting a unique role in processing taste input from the posterior tongue. PMID: 15121234
  16. The NK3R receptor has a role in tanscription regulation in hypotension-induced tachykinin release in the supraoptic nucleus. PMID: 15537880
  17. These data suggest that NKB neurons could indirectly influence anterior pituitary function by inputs to arcuate neuroendocrine neurons, but through a receptor other than NK3R. PMID: 16025449
  18. NK(3) receptors are available in cytoplasmic reserve in dopaminergic neurons, but more immediately accessible at the plasmalemmal surface of non-dopaminergic dendrites in both the SN and VTA. PMID: 17197098
  19. Data provide evidence that neurokinin 3 receptors are involved in the control of the hyperlocomotor and nucleus accumbens dopamine response to cocaine, but not in cocaine-induced conditioned place preference. PMID: 17445241
  20. NK3R activation contributes significantly to the systemic release of both vasopressin and oxytocin in response to osmotic and hypotensive challenges. PMID: 17522129
  21. NK3R signaling in magnocellular neurons has a critical role for the release of VP and OT in response to hypotension. PMID: 18650316

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1