Recombinant Rat Neurotensin receptor type 2(Ntsr2)

Code CSB-CF717371RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q63384
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence METSSPWPPRPSPSAGLSLEARLGVDTRLWAKVLFTALYSLIFAFGTAGNALSVHVVLKA RAGRPGRLRYHVLSLALSALLLLLVSMPMELYNFVWSHYPWVFGDLGCRGYYFVRELCAY ATVLSVASLSAERCLAVCQPLRARRLLTPRRTRRLLSLVWVASLGLALPMAVIMGQKHEV ESADGEPEPASRVCTVLVSRATLQVFIQVNVLVSFALPLALTAFLNGITVNHLMALYSQV PSASAQVSSIPSRLELLSEEGLLGFITWRKTLSLGVQASLVRHKDASQIRSLQHSAQVLR AIVAVYVICWLPYHARRLMYCYIPDDGWTNELYDFYHYFYMVTNTLFYVSSAVTPILYNA VSSSFRKLFLESLGSLCGEQHSLVPLPQEAPESTTSTYSFRLWGSPRNPSLGEIQV
Source in vitro E.coli expression system
Gene Names Ntsr2
Protein Names Recommended name: Neurotensin receptor type 2 Short name= NT-R-2 Short name= NTR2 Alternative name(s): High-affinity levocabastine-sensitive neurotensin receptor
Expression Region 1-416
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the tridecapeptide neurotensin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Neurotensin receptor subfamily, NTSR2 sub-subfamily
Tissue Specificity Abundant in cortex and hypothalamus, and lower levels seen in the heart and intestine.
Database Links

KEGG: rno:64636

STRING: 10116.ENSRNOP00000067549

UniGene: Rn.127792

Related Products

Ntsr2 Proteins

Ntsr2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.