Recombinant Rat Nociceptin receptor (Oprl1)

Code CSB-CF016360RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Oprl1; Oor; Oprl; Nociceptin receptor; Kappa-type 3 opioid receptor; KOR-3; Orphanin FQ receptor; ROR-C; XOR1
Species
Rattus norvegicus (Rat)
Expression Region
1-367
Target Protein Sequence
MESLFPAPYWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCI GGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALC KTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGV PVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLR GVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRF CTALGYVNSCLNPILYAFLDENFKACFRKFCCASSLHREMQVSDRVRSIAKDVGLGCKTS ETVPRPA
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
Gene References into Functions
  1. The present in vitro and in vivo findings show that nociceptin/orphanin FQ receptor plays a crucial conserved role regulating the levels of the glutamate/aspartate transporter GLAST/EAAT1 in both human and rodent brain astrocytes. PMID: 28906039
  2. Genetic deletion of NOP receptors confers resilience to drug abuse and support a role for NOP receptor antagonism as a potential treatment option for drug addiction. PMID: 27562376
  3. Nociceptin/orphanin FQ mRNA is increased in the striatum from stressed, social defeat animal models. PMID: 28280884
  4. Findings suggest that the Galphai1/Gbeta2(beta4)/Ggamma7 heterotrimeric G protein complex determines the nociceptin/orphanin FQ peptide receptor-mediated modulation of voltage-gated Ca(2+) channels channels in stellate ganglion neurons. PMID: 27238748
  5. The opioid-like hepta-decapeptide nociceptin/orphanin FQ and its receptor nociceptin are widely distributed in the central nervous system where they are involved in a variety of biological functions including feeding, reward and emotional processes. PMID: 26387568
  6. This study demonstrated the expression of the NOP receptor in human peripheral nerve and visceral tissues, with a marked increase of NOP-positive nerve fibres in urinary bladder syndromes. PMID: 27127846
  7. Study shows an influence of the prelimbic nociceptin/orphanin FQ neurotransmission, but not the infralimbic nociceptin receptors, in the control of cardiovascular responses observed during acute stress, by increasing cardiac parasympathetic activity. PMID: 26935148
  8. Nociceptin-immunoreactive cells were observed in the central and peripheral regions of the islets of both normal and diabetic rat pancreas. PMID: 25875798
  9. This study demonistrated that Oprl1 and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  10. Antagonism of endogenous N/OFQ produces anti-arrhythmic effects on ventricular arrhythmias in acute myocardial infarction, possibly via modulating PKC activity and action potential of myocytes. PMID: 23869704
  11. data are consistent with the interpretations that membrane estrogen receptor activation attenuates ORL1-mediated antinociception through a non-genomic, ERK 2-dependent mechanism in females PMID: 24452062
  12. These results confirm the existence of reciprocal interactions between serotonin and nociceptin/NOP transmissions in the dorsal raphe nucleus. PMID: 23669068
  13. Opioid/nociceptin receptor levels are increased in the cerebral cortex following kainic acid-induced seizures. PMID: 23337899
  14. the findings elaborate the effects of the N/OFQ-NOP system on cocaine-mediated extracellular dopamine; these studies confirm the widespread involvement of NOP receptors in drug addiction PMID: 23219985
  15. stress can affect N/OFQ expression and that glucocorticoids may constitute hormonal mediators of this complex interplay. PMID: 22074385
  16. ORL1 receptors are enriched in a subpopulation of sensory neurons and prolonged activation produces no functional loss of surface N-type calcium channels PMID: 22371475
  17. Genetic knock-out of nociceptin receptor renders rats more susceptible to the rewarding effect of morphine. PMID: 21095077
  18. results indicate that the peripheral nociceptin/orphanin FQ (N/OFQ)-N/OFQ peptide (NOP) system is involved in stress-induced reduction of mucosal mast cell density PMID: 21925513
  19. NOP receptor signalling plays an important role in controlling anxiety- and mood-related behaviours, exercise-driven locomotor activity and nociception. PMID: 21184763
  20. present in the uterus PMID: 20237332
  21. These receptors exhibit differential blocker pharmacology and allosteric regulation by sodium. PMID: 20159949
  22. the existence of heterodimers between ORL1 and classical opioid receptors, with profound implications for effectors such as N-type calcium channels. PMID: 19887453
  23. Activation of spinal ORL-1 receptors prevents acute cutaneous neurogenic inflammation: role of nociceptin-induced suppression of primary afferent depolarization. PMID: 11973003
  24. ORL-1 receptors in layer V of anterior cingulate cortex are located on somatodendritic elements and deafferentation increases ORL-1 receptor binding. PMID: 12842128
  25. Long-term effects on brain opioid receptor like-1 receptors after short periods of maternal separation in rats. PMID: 12842289
  26. Expression of opioid receptor-like OP-4/ORL1 is detected in the intima of ex vivo rat aortic rings, where the signal is limited to the endothelial layer, and in endothelial cells from rat brain microvessels. PMID: 14660000
  27. These results provide the evidence that ORL1-mu opioid receptor heterodimerization and the resulting impairment of mu receptor-activated signaling pathways may contribute to ORL1-mediated antiopioid effects in the brain. PMID: 15748148
  28. ORL(1) was involved in nociceptive transmission of neuropathic pain PMID: 15862535
  29. ORL1 receptors are located on serotoninergic neurons in the dorsal raphe nucleus PMID: 15948180
  30. These results suggest that two C-terminal serine residues, Ser(334) and Ser(335), are required for homologous desensitization and agonist-induced phosphorylation of opioid receptor-like 1. PMID: 16019191
  31. These results suggest that opioid receptor like 1 receptors have an inhibitory effect at night, and a facilitative effect in the day, on phase changes. PMID: 16310969
  32. NOP receptor agonists evoked a hyperphagic effect while NOP receptor antagonists blocked the hyperphagic effect. PMID: 16483692
  33. Changes in expression of nociceptin and its receptor in spinal dorsal horn during electroacupuncture treatment for inflammatory pain were studied. PMID: 17493706
  34. Altered anxiety behavior was studied in nociceptin receptor gene knockout mice. PMID: 17499882
  35. Results suggest that NOP receptor activation is required for cannabinoids to produce hypothermia. PMID: 17512052
  36. In conclusion, we present a novel mutant rat lacking NOPr without compensatory changes in mu, delta and kappa opioid receptors. We anticipate that this mutant rat will have heuristic value to further understand the function of NOPr. PMID: 19527777
  37. These data suggest that the endogenous nociceptin system is responsive to changes in energy balance and that nociceptin receptors specifically within the dorsal raphe may be physiologically relevant to nociceptin's effects on appetite. PMID: 19765615

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in several brain areas, the intestine, liver and spleen. Detected in sympathetic stellate ganglion neurons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1