Recombinant Rat P2Y purinoceptor 13(P2ry13)

Code CSB-CF750219RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6GUG4
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNST FIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETMYVGIMMLGLI AFDRFLKIVVPFRKTFVKKTAFAKIVSISIWLLMFLISLPNMILNKEATASTVKKCASLK SPLGLLWHQVVSHTCQFIFWTVFILMLLFYTVIAKKVYDSYRKFKSRDSKHKRLEAKVFI VMAVFFVCFAPFHFVRVPYTHSQTTNKTDCRLENQLFLAKESTLFLATTNICMDPLIYII LCKKFTRKVPCMRWRTKTAASSDEHHSSQTDNITLS
Source in vitro E.coli expression system
Gene Names P2ry13
Protein Names Recommended name: P2Y purinoceptor 13 Short name= P2Y13
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highest levels in spleen, liver brain and kidney. Lower but significant level are also detected in intestine, stomach, skeletal muscle, testis, heart and lung.
Database Links

KEGG: rno:310444

STRING: 10116.ENSRNOP00000047532

UniGene: Rn.209780

Related Products

P2ry13 Proteins

P2ry13 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.