Recombinant Rat Pannexin-1 (Panx1)

Code CSB-CF017425RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Panx1; Px1; Pannexin-1
Species
Rattus norvegicus (Rat)
Expression Region
1-426
Target Protein Sequence
MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILL YLPALFWRFAAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQ SLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFAVVLLACIYLSYYFSLSSLS DEFLCSIKSGVLRNDSTIPDSFQCKLIAVGIFQLLSLINLLVYALLVPVVIYTLFVPFRQ KTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGI DPMLLLTNLGMIKMDVIDGKVPMSLQTKGEDQGSQRMDFKDLDLSSETAANNGEKNSRQR LLNSSC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis.
Gene References into Functions
  1. the upregulation of Pannexin1 expression may be involved in apoptosis and degeneration of neurons in the rat brain following ICH, and may contribute to subsequent cognitive dysfunction. PMID: 29484398
  2. panx1 contributes to distension- or LPS-evoked ATP release into the lumen of the bladder and that luminal release can modulate voiding function. PMID: 25630792
  3. Px1 channels releasing ATP have any role in the constrictor actions of alpha1-adrenoceptor activation PMID: 25637780
  4. These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7Rs PMID: 25170954
  5. It was shown that angiotensin signaling in type II cells activates an inward current carried by Panx1 channels. PMID: 25172944
  6. ETV4 and cAMP response elements play a role in the transcriptional regulation of Panx1 in the epididymis. PMID: 25376229
  7. Panx1 up-regulation contributes to pain hypersensitivity induced by nerve injury. PMID: 25925949
  8. Study found that astrocytes released ATP in response to mechanical strain, with pannexin 1 the predominant efflux pathway PMID: 24839011
  9. Pannexin-1 hemichannels regulate urothelial overactivity in the bladder via activation of uracil nucleotidetide (UDP)-sensitive P2Y6 receptors. PMID: 24269631
  10. These results suggest that panx1 contributes to pathophysiological ATP release in lipoapoptosis induced by saturated FFA; panx1 may play a role in hepatic inflammation by mediating an increase in extracellular ATP concentration in lipotoxic liver injury. PMID: 22972801
  11. Activation of NMDA receptors during anoxia/ischemia recruits Src family kinases to open Panx1 channels, leading to sustained neuronal depolarizations. PMID: 22956847
  12. pannexin 1 is expressed in smooth muscle but not in endothelium of middle cerebral arteries. PMID: 22301733
  13. The results suggest that Panx1c and Panx1d may serve as dominant-negative effectors to modulate the functions of Panx1a through formation of heteromeric channels. PMID: 21907716
  14. ATP, released through Px1 hemichannels, activates purinergic P2X7 receptors, resulting in the closure of Px1 hemichannels during ischemia. PMID: 21185900
  15. Overexpression of pannexins 1 and 2 in pituitary cells enhanced the release of ATP. PMID: 21467198
  16. indicate that the oligomerization and trafficking of Panx1 are regulated by the C-terminal domain, whereas internalization of long lived Panx1 channels occurs in a manner that is distinct from classical endocytic pathways PMID: 21659516
  17. In the testis, Panx1 localized to the basal compartment of the seminiferous epithelium, while Panx3 was expressed in Leydig cells. In the ED, both Panxs were expressed in the apical region of ciliated cells. PMID: 21337450
  18. Panx1 channels potentially promote arrhythmogenic activities. PMID: 21041301
  19. Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each other PMID: 20516070
  20. Panx1 and Panx3 are coexpressed in the mammalian epidermis, and the regulation of Panx1 plays a key role in keratinocyte differentiation. PMID: 20332104
  21. New insight into relationship of decreased glucose to increased seizure threshold is established through neuronal adenosine triphosphate (ATP) release via pannexin hemichannels and hippocampal adenosine A1 receptors coupled to potassium ATP channels. PMID: 20237259
  22. although Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency appears to be independent of cell contacts and the need for intact microtubules PMID: 20086016
  23. the different expression patterns of pannexin 1 (Panx1) and pannexin 2 (Panx2) in the brain indicate that pannexins form cell type-specific gap junctions with distinct properties that may subserve different functions. PMID: 14597722
  24. Panx1 and Panx2 are abundantly expressed in the retina, and may therefore contribute to the electrical and metabolic coupling, or to signaling between retinal neurons PMID: 16616526
  25. Has kinetics and dynamics that make it unique to serve distinct functions separate from connexin-based channels. PMID: 18649184
  26. Results show that pannexins 1, 2, and 3 are abundantly expressed in the mouse and rat cochlea and demonstrate distinct cellular distributions. PMID: 19009624
  27. study concludes that Px1 hemichannel opening is triggered by NMDAR stimulation and can contribute to epileptiform seizure activity PMID: 19056988
  28. in contrast to macrophages and monocytes in which low intracellular K(+) has been suggested to trigger inflammasome activation, in neural cells, high extracellular K(+) activates caspase-1 probably through pannexin 1 PMID: 19416975

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Pannexin family
Tissue Specificity
Expressed in the eye, thyroid, prostate, kidney and liver. Abundantly expressed in the CNS, including hippocampus, olfactory bulb, cortex, cerebellum and white matter.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1