Recombinant Rat Probable G-protein coupled receptor 156(Gpr156)

Code CSB-CF817004RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8K451
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITDSQHGSADISPLSPALLGVIWTFLSCG LLLVLFFLAFTIRCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDALVGSSVEALI QTRLSLLCIGTTLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILL VTWVLTDPIQCLQILGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGA YLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT TTVNCCVFLPQLRQRKAFEGENQTIRHMAKYFSTPSKTFRSKFDEDQSCHLRDEXSCMER LLTEKNAVIESLQEQVSNAKEKLVKLMSAECALDSPEWAVPAAASAGGPAECXATSEKES GAAAEDSLPASAASQHMQGPGASRRDXSPSPDQKYDMPLKQFCDHLDMGCSQKPKAEQSE GPERGNQEPMAPGQSLMTDGVACEPHRPRQNSEVLPERLPRVSSVVREKLQEVLQELDLG TEAPLSPLPCPQQPWKSNTSGSPQKLSPSKLGFSPYVVRRRRAAQRARSRIPGSVGLKMG HQANNTVSGSQNGLIVQNRDSPRLDHHNARSKEPRSSSVKPSPISAPHQRRGSLEGSKQC ETEPQEARGYSVAFPRQPSASAPAQSSTAPCLSSXPALPRQRQPLPLLSPGCPSLSSGCY NLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQTSGLASWEKLLARSKPV VNFKDDLKPTLV
Source in vitro E.coli expression system
Gene Names Gpr156
Protein Names Recommended name: Probable G-protein coupled receptor 156 Alternative name(s): GABAB-related G-protein coupled receptor
Expression Region 1-792
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 3 family, GABA-B receptor subfamily
Tissue Specificity Widely expressed throughout the brain and is particularly dense in the olfactory tubercles, islands of Calleja, nucleus accumbens, piriform cortex and all fields of the hippocampus.
Database Links

KEGG: rno:260430

STRING: 10116.ENSRNOP00000003773

UniGene: Rn.213724

Related Products

Gpr156 Proteins

Gpr156 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.