Recombinant Rat Probable G-protein coupled receptor 85(Gpr85)

Code CSB-CF009837RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60895
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI
Source in vitro E.coli expression system
Gene Names Gpr85
Protein Names Recommended name: Probable G-protein coupled receptor 85 Alternative name(s): PKrCx1 Super conserved receptor expressed in brain 2
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: rno:64020

STRING: 10116.ENSRNOP00000031780

UniGene: Rn.53985

Related Products

Gpr85 Proteins

Gpr85 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.