Recombinant Rat Protein FAM134B(Fam134b)

Code CSB-CF691821RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5FVM3
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MASPAPEEHATQGCPATEEQEPRPGVPGEEAGPEGAGPQVEEAAGRVAAALTWLLGEPVL WLGWRADELLSWKRPLRSLLAFLGANLLFWFLALTPWRVYHLISVMILGRVIMQIIKDMV LSRARGAQLWRSLSESWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFC LLVCSVCTFFTILGSYIPGVILSYLLLLFAFLCPLFKCNDIGQKIYSKVKSILLKLDFGI GEYINQKKRERSEADKEKSHKDDSEIDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNG TFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGAGTNDEDELSLGLPTELKTKK QQLNSAHRPSKDRQSAAGLSLPLKSDQALHLMSNLAGDVITAAMTAAIKDQLEGARQALA QAAPTPGDDTDTEEGDDFELLDQAELDQIESELGLTQDQGAEAQQSKKSSGFLSNLLGGH
Source in vitro E.coli expression system
Gene Names Retreg1
Protein Names Recommended name: Protein FAM134B
Expression Region 1-480
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into lysosomes through sequestration into autophagosomes. Promotes membrane remodeling and ER scission via its membrane bending capacity and targets the fragments into autophagosomes via interaction with ATG8 family proteins. Required for long-term survival of nociceptive and autonomic ganglion neurons.
Subcellular Location Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families RETREG family
Database Links

KEGG: rno:103689968

STRING: 10116.ENSRNOP00000062258

UniGene: Rn.162560

Related Products

Retreg1 Proteins

Retreg1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.