Recombinant Rat Short transient receptor potential channel 1 (Trpc1)

Code CSB-CF879434RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Trpc1
Uniprot No.
Alternative Names
Trpc1; Trp1; Short transient receptor potential channel 1; TrpC1; Transient receptor protein 1; TRP-1
Species
Rattus norvegicus (Rat)
Expression Region
1-759
Target Protein Sequence
MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY YMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQKLMERIQNPEY STTMDVAPVILAAHRNNYEILTMLLKQDVALPKPHAVGCECTLCSAKNKKDSLRHSRFRL DIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFWNDYEELARQCKMFAKDLLA QARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTV WFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASY FTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEES RNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLF FMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVV IVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYM ISSLSKWVCSHTSKGKVRRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD QATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPKN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Seems to be also activated by intracellular calcium store depletion.
Gene References into Functions
  1. transfection of TRPC1-shRNA for 48h partially inhibited Nampt-induced expression of ER stress markers and BNP in H9c2 cells. Our data suggest that TRPC1 might play an important role in cardiomyocyte hypertrophy induced by Namptinan ER stress-dependent way. PMID: 28478801
  2. the increased right ventricular systolic pressure and right ventricular hypertrophy are likely related to enhanced SOCE and upregulated TRPC1 and TRPC6 expression levels in the distal pulmonary artery. PMID: 26155749
  3. Orai1 and TRPC1, which form SOCs regulated by STIM1, play a key role in the effect of ACh on GSIS, a process that may be impaired in type 2 diabetes. PMID: 26494622
  4. Our data demonstrates that endothelin-1-mediated influx of extracellular Ca(2+) activates transient receptor potential canonical channels 1 and 6 in cerebral vascular smooth muscle cells. PMID: 25939574
  5. This study demonstrated that trpc1 expression in rat auditory midbrain neurons. PMID: 25627107
  6. we concluded that BMP4 activated Smad1/5/8 pathway is BMPRII-dependent, while the BMP4 - ERK/p-P38 - TRPC - SOCE signaling axis are likely mediated through other receptor rather than BMPRII PMID: 25461595
  7. up-regulation may be involved in carotid arterial remodeling in spontaneously hypertensive rats PMID: 25649357
  8. The upregulation of TRPC1 contributes to the contractile function in the hypertrophic myocardium by increasing [Ca(2+)]i through the SACs. PMID: 24107839
  9. Suggest that chronic cigarette smoke-induced changes in vascular tone and structure in PA and the development of pulmonary hypertension might be largely due to upregulation of TRPC1 and TRPC6 expression. PMID: 24336649
  10. TRPC1 containing channels might represent focal points for co-ordination of Ca2+ and Na+ signalling in astroglia. PMID: 23764169
  11. Experimental subarachnoid hemorrhage significantly increased mRNA and protein expressions of TRPC1 in rats. PMID: 23542055
  12. Report TRPC1 expression in hippocampal neurons in response to corticosterone. PMID: 23169006
  13. STIM1 plays an important role in the regulation of intestinal epithelial cell (IEC) apoptosis by altering TRPC1 activity, and ectopic STIM1 expression sensitizes IECs to apoptosis through induction in TRPC1-mediated Ca(2+) influx. PMID: 22547346
  14. the regulation of neurite outgrowth by TRPC1 is independent of Ca(2) influx and TRPC1-promoted neurite outgrowth depends on the surface expression of TRPC1. PMID: 22201561
  15. Suppression of TRPC1 inhibits endothelial progenitor cells proliferation and migration. PMID: 21361857
  16. a novel regulatory mechanism relying on the expression of TRPC1 and the subsequent formation of heteromeric TRPC channel complexes with reduced calcium permeability, thereby fine-tuning neuronal migration. PMID: 22157757
  17. TRPC1 expression and distribution in rat hearts PMID: 22073358
  18. STIM1 physically interacts with TRPC1 in IECs and the formation of STIM1/TRPC1 complex is necessary for the activation of TRPC1 channels during restitution after wounding. PMID: 20631248
  19. Expression levels of TRPC1 and TRPC6 ion channels are reciprocally altered in aging rat aorta and age related vasospasm disorders. PMID: 20431989
  20. These findings provide new insights about a mechanistic basis for the activation of the calcineurin/NFAT pathway by 5-HT(2A) receptors and highlight the critical role of TRPC1 in the development of cardiac hypertrophy. PMID: 20005206
  21. Sildenafil may alter basal calcium in pulmomary artery smooth muscle cells suggesting a cause and effect link between increases of TRPC1 expression and development of pulmonary hypertension. PMID: 19889962
  22. These results suggest that cholesterol influences vascular reactivity to endothelin-1 by affecting the caveolar localization of TRPC1. PMID: 14551243
  23. mGluR1-evoked slow EPSC is mediated by the TRPC1 cation channel PMID: 14614461
  24. TRPC1 contributes to basic fibroblast growth factor (bFGF)/FGF receptor-1-induced Ca2+ influx, which is involved in self-renewal of embryonic rat neural stem cells. PMID: 15758179
  25. TRPC1 channels in sinus endothelial cells of the spleen might play an important role in controlling blood cell passage through phenomena including cytoskeletal reorganization, cell retraction, and disassembly of adherens junctions. PMID: 15856275
  26. These findings strongly suggest that TRPC1 functions as store-operated Ca(2+) channels and plays a critical role in intestinal epithelial restitution by regulating CCE and intracellular [Ca(2+)](cyt). PMID: 16282360
  27. results indicate that TRPC1 proteins function as Ca2+ permeable channels in intestinal epithelial cells and play a critical role in the regulation of apoptosis PMID: 16551274
  28. We found a coexpression of TRPC1 and mGluR1 receptors in dendrites of the substantia nigra dopaminergic neurons. This reinforces the concept of an involvement of TRPC1 in mGluR1-mediated excitatory inputs in rat dopamine neurons PMID: 16930403
  29. establish TRPC1 as a functionally important regulator of cardiac hypertrophy PMID: 17174323
  30. dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in activation of SOC channel in response to internal Ca2+ store depletion PMID: 17224452
  31. TRPC1 plays an important role in controlling contractile function of MC. Mediation of Ca(2+) entry might be the underlying mechanism for the TRPC1-associated MC contraction. PMID: 17389736
  32. These findings shed new light on the constituents of the D2R signalplex, and support the involvement of D2Rs in cellular calcium signaling pathways via a novel link to TRPC channels. PMID: 18261457
  33. Induced TRPC1 expression increases protein phosphatase 2a(PP2A) activity through Ca2+ influx; increased PP2A sensitizes intestinal epithelial cells to apoptosis as a result of NF-kappaB inactivation. PMID: 18322138
  34. These data indicate that Ca2+ entry through TRPC1 channels contributes to Ca2+ signaling in astrocytes and the consequent glutamate release from these cells. PMID: 18338793
  35. Report the properties of Orai1 and IP3 receptor-operated TRPC1 channels. PMID: 18711860
  36. results suggest that decrease in TRPC1 may be compensated by upregulated TRPC6 that possibly takes part in store-operated Ca2+ entry in vascular smooth muscle cells PMID: 19386284
  37. study concludes TRPC1 and TRPC6 channels cooperate with TRPV4 channels to mediate mechanical hyperalgesia and primary afferent nociceptor sensitization, although they may have distinctive roles PMID: 19439599
  38. STIM1 together with TRPC1 plays a pivotal role as a functional regulator of cardiac hypertrophy. PMID: 19715666

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC1 sub-subfamily
Tissue Specificity
Expressed in brain, hippocampus, amygdala, Purkinje cells and single neurons in the cortex and striatum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1