Recombinant Rat Thromboxane A2 receptor (Tbxa2r)

Code CSB-CF023260RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor; TXR2
Species
Rattus norvegicus (Rat)
Expression Region
1-341
Target Protein Sequence
MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase.
Gene References into Functions
  1. We conclude that hyperglycemia activates thromboxane A2 receptor to impair the integrity and function of blood-brain barrier via the ROCK-PTEN-Akt-eNOS pathway. PMID: 28415790
  2. Data suggest that thromboxane A2/Tbxa2r-mediated vasoconstriction of intracavernous small penile arteries depends on Ca2+ influx through L-type calcium channels and TRP (transient receptor potential) channels, and ROCK- (Rho kinase)-dependent mechanisms in vascular smooth muscle. PMID: 26708952
  3. The experiments suggest that in the SHR but not the WKY aorta, alpha1 -adrenoceptor activation desensitizes TP receptors through activation of PKC-epsilon. PMID: 25857252
  4. Low-dose TP stimulation constricts the ductus arteriosus with minimal adverse effects at least in rat neonates. PMID: 22717688
  5. analysis of hypersensitivity to the thromboxane receptor mediated cerebral vasomotion and CBF oscillations during acute NO-deficiency in rats PMID: 21217826
  6. vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction. PMID: 20959415
  7. Here we examined a role of PPAR-gamma in TXR gene expression in VSMCs PMID: 11777901
  8. These results suggest that the impaired functional vasodilation in diabetic rats is due to hyperglycemia-mediated increases in TP-mediated vasoconstriction. PMID: 16905600
  9. post-transcriptional mechanisms are responsible for the up-regulation of TP receptor by lipid soluble smoke particles, in which enhanced translation is the major cause of the elevated protein expression and the enhanced contraction. PMID: 17706224
  10. These studies demonstrated that thromboxane A(2) receptorss couple to both G(q) and G(13) in the extranuclear compartment but only to G(s) in the nuclear compartment. PMID: 18710937
  11. Transcriptional down-regulation of thromboxane A(2) receptor expression via activation of MAPK ERK1/2, p38/NF-kappaB pathways. PMID: 18769070

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In the brain, expressed in all types of glial cells. In the kidney, expressed in the mesangial cells of the glomerulus, smooth muscle cells of the renal arterioles, and in transitional cell epithelium of renal pelvis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1