Recombinant Rat Type II iodothyronine deiodinase (Dio2)

Code CSB-CF302542RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Dio2
Uniprot No.
Alternative Names
Dio2; Itdi2; Txdi2Type II iodothyronine deiodinase; EC 1.21.99.4; 5DII; DIOII; Type 2 DI; Type-II 5'-deiodinase
Species
Rattus norvegicus (Rat)
Expression Region
1-266
Target Protein Sequence
MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGL RCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERP LVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVK KHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGG KGPFSYNLQEVRSWLEKNFSKRUILD
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.
Gene References into Functions
  1. Glucocorticoids inhibited the adrenergic stimulation of Dio2 at the transcriptional level in brown adipocytes. PMID: 26994513
  2. This study demonstrated that reduction of the Dio2 mRNA expression in hippocampus of thyroidectomized Wistar rats. PMID: 26861177
  3. These studies reveal that tissue-specific differences in D2 ubiquitination are an inherent property of the TRH/TSH feedback mechanism PMID: 25555216
  4. cold exposure is accompanied by concerted changes in the metabolism of BAT and oxidative and glycolytic skeletal muscles that are paralleled by type 2 deiodinase activation PMID: 25294216
  5. results of the present study hypothesize that progesterone withdrawal may underlie the decrement in D2 expression, with consequent reduction in the peripheral conversion of T4 into T3 leading to a hypothyroid state. PMID: 24362948
  6. Data suggest that type 2 deiodinase is induced in inflammation of tanycytes (as in inflammation of periventricular area, arcuate nucleus, and median eminence of hypothalamus); this enzyme induction appears to involve NFkappaB signaling. PMID: 24635351
  7. Data suggest that type 2 deiodinase induction (and kinetics of induction) in animal models of inflammation of leptomeninges, choroid plexus, and brain blood vessels is tissue specific and species specific. PMID: 24601886
  8. In rat articular cartilage, DIO2 is specifically expressed among deiodinases and dominantly expressed the same as in brown adipose tissue. PMID: 23296253
  9. Data indicate that low-iodine diets induces changes in deiodinase activities, especially in the thyroid, to counteract the low T(4) synthesis and secretion, contributing to maintain the local T(3) concentrations in the tissues with D2 activity. PMID: 23142811
  10. Results indicate that, beside activation of CREB, epigenetic factors such as histone modifications also play an important role in regulating Dio2 transcription. PMID: 21704117
  11. T3 increases the adrenergic stimulation of UCP1 and D2 expression mostly via the TRbeta1 isoform, and in brown adipocytes, D2 is protected from degradation by the action of T3 on TRbeta1. PMID: 20719854
  12. In addition to TSH, other factors derived from the pars tuberalis may contribute to LPS-induced D2 activation in tanycytes. PMID: 20501675
  13. Triiodothyronine is required for the stimulation of type II 5'-deiodinase mRNA in rat brown adipocytes. PMID: 11934678
  14. induction of thyroid hormone-degrading deiodinase in cardiac hypertrophy and failure PMID: 12072417
  15. data do not support that thyroxine-binding protein p29 has a functional relationship with D2 PMID: 12586781
  16. D2 activity not induced by decidualization stimulus. In spontaneously cycling female rats, both D2 and D3 were observed to be 3- to 8-fold higher in proestrus, compared with diestrus. PMID: 12959985
  17. the suprachiasmatic nuclei separately stimulates D2 activity as well as the hypothalamo-pituitary-thyroid axis PMID: 15550511
  18. MAPK signaling is required for the adrenergic stimulation of D2 activity and mRNA PMID: 15691884
  19. appropriate induction of Dio2 activity during negative energy balance is dependent upon both leptin and glucocorticoid signaling. PMID: 15746256
  20. Hypoxia leads to stabilization of D2 by slowing its degradation by the proteasome pathway. PMID: 17615150
  21. Correlation between relative mRNA levels of WSB-1 and USP-33 in numerous tissues that do not express type 2 deiodinase(D2) suggests that these ubiquitin-related enzymes share additional substrates besides D2. PMID: 17628004
  22. Induction of type 2 iodothyronine deiodinase in the mediobasal hypothalamus by bacterial lipopolysaccharide. PMID: 18218695
  23. The proteins encoded by rat and human Dio2 (deiodinase, iodothyronine, type II) genes are selenoproteins. PMID: 8755651

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
Iodothyronine deiodinase family
Tissue Specificity
Expressed in cerebral cortex, cerebellum, pituitary gland, mostly in anterior pituitary gland, and pineal gland, as well as in brown adipose tissue (BAT).
Database Links

KEGG: rno:65162

UniGene: Rn.88380

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1