Recombinant Rhizobium meliloti RpoH suppressor (suhR)

Code CSB-CF323378RKU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
suhR
Uniprot No.
Alternative Names
suhR; R02096; SMc01492; RpoH suppressor
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Expression Region
1-633
Target Protein Sequence
MARTPAKYCDLVMKGGITSGIVYPNAALALARDYRFKNIGGTSAGAIAAAACAAAAVGDR RKQMKAAIAQPEERVGFEGLAKASANLASPGFIKDLLQPAAGAGQAFRLLVTLAGNTGVL RKGVALLGSVVRIAPVETLLLLAALAGLAYAVGGQTGMIAAALPAAICAYLGGVVFAVLR IARVLRRNLMGLCTGTAPDQPARRPRMVLTDWLHETLQALSGKASGQPLTFGDLWTAERY PGEPGSDRAVTLKMITTGISHQEPRSLPFESALFWFRRKEFEALFPKVVVDWMVEKAGEP VTVAGEDYYLLPHGADMPVLVATRMSLSFPLLISAVPLHEPARRESLPGSDGENEAEDTT SDEDEQKTVLDSTEALTTGGKKRRARPAAFRICWFSDGGISSNFPIHLFDRALPRWPTFA INLVYPETSDTGSRPEVFLPENNRQGWQRHYQPIARKSAVHELCAFVFAIVATMQNWRDL LQSRAPGHRERIVHVSLSPQEGGLNLAMSKEVLAAVSKKGTAAGEAFARFSFENHYWIRW RNLASALQRYTIDIAASDAYRPKIPDYEPAYALAHDATSKPPSYRFASKAEREEAARLLE KLIGEGEKWSGEGPDLTKTAPRPLPQLQIAPTY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein is non-essential for R.meliloti growth, but induces a heat-shock response in temperature-sensitive E.coli K165 by elevating levels of sigma 32 (mechanism unknown).
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1