Recombinant Saccharomyces cerevisiae ADP,ATP carrier protein 2 (PET9)

Code CSB-CF323574SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PET9
Uniprot No.
Alternative Names
PET9; AAC2; YBL030C; YBL0421; ADP,ATP carrier protein 2; ADP/ATP translocase 2; Adenine nucleotide translocator 2; ANT 2; Petite colonies protein 9
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-318
Target Protein Sequence
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG VISMYDQLQMILFGKKFK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Gene References into Functions
  1. Yeast aac2 R96H and aac2 R252G mutations are equivalent to R80H and R235G human ANT1 pathological mutations. mtDNA instability induced by aac2R96H and aac2R252G is rescued by N-acetylcysteine. PMID: 28947214
  2. Mutations in yeast Aac2, equivalent to those in human Ant1 in progressive external ophthalmoplegia, cause protein misfolding. Misfolded Aac2 affects assembly & stability of multiple protein complexes in membrane, which ultimately inhibits cell growth PMID: 25833713
  3. The protective role of cathepsin D in acetic acid-induced apoptosis depends on ANT (Aac2p) but not on the voltage-dependent channel (Por1p). PMID: 23220089
  4. Yeast ADP/ATP carrier isoform 2: conformational dynamics and role of the RRRMMM signature sequence methionines PMID: 21868387
  5. Aac2p and Sal1p may define two parallel pathways that transport a nucleotide substrate in an operational mode distinct from ADP/ATP exchange. PMID: 15238515
  6. The dynamic structural change that occurs in the twisting of the second transmembrane alpha-helix of yeast mitochondrial ADP/ATP carrier (AAC) between matrix-state and cytosol-state gives new insights into the process of AAC substrate translocation. PMID: 15568812
  7. the structural and functional features of the cytosolic-facing first loop (LC1) including its surrounding region PMID: 15628859
  8. The functional form of Ancp is a dimer. PMID: 16274221
  9. Results indicate that the matrix loop m2 of the mitochondrial ADP/ATP carrier intrudes to some extent into the inner mitochondrial membrane and may be involved in the translocation of ADP/ATP. PMID: 16331992
  10. the C-terminal region of the second cytosolic loop in AAC2 changes its environment when the carrier cycles between the matrix and cytosolic state. PMID: 16962388
  11. the residual transport activity in the presence of MTSES depended linearly on the amount of cysteine-less carrier. Thus, the entire transport cycle for ADP/ATP exchange is carried out by the monomer PMID: 17566106
  12. yeast ADP/ATP carriers are monomeric in detergents in agreement with their hydrodynamic properties PMID: 17572439
  13. the Anc2p C-terminal region is involved in nucleotide recognition, binding, and transport PMID: 18299327
  14. Pleiotropic effects of the yeast Sal1 and Aac2 carriers on mitochondrial function via an activity distinct from adenine nucleotide transport. PMID: 18431598
  15. Aac2 exists in physical association with the cytochrome bc1-COX supercomplex and the TIM23 machinery PMID: 18614795
  16. Pathogenic mutations likely enhance the intrinsic proton-conducting activity of adenine nucleotide translocase Aac2, which excessively uncouples the mitochondrial inner membrane thereby affecting energy transduction and mitochondrial biogenesis. PMID: 18809618
  17. Tyr203 and Phe208, aromatic residues of Anc2 transmembrane domain 4 protein carrier, may play a role in nucleotide attraction and its progress through the carrier leading to a productive adenosine diphosphate/adenosine triphosphate exchange. PMID: 19086155

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Database Links

KEGG: sce:YBL030C

STRING: 4932.YBL030C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1