Recombinant Saccharomyces cerevisiae Beta-1,6-glucan synthesis-associated protein KEG1(KEG1)

Code CSB-CF331892SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43614
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQ AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR VVLLAYFPVLLTAYKKLLTK
Source in vitro E.coli expression system
Gene Names KEG1
Protein Names Recommended name: Beta-1,6-glucan synthesis-associated protein KEG1 Alternative name(s): KRE6-binding ER protein responsible for glucan synthesis protein 1
Expression Region 1-200
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the biosynthesis of (1->6)-beta-D-glucan polymers of the cell wall. Required for viability. Involved in maintaining chromosome stability.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Database Links

KEGG: sce:YFR042W

STRING: 4932.YFR042W

Related Products

KEG1 Antibodies

KEG1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

KEG1 Proteins

KEG1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.