Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)

Code CSB-CF007134SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14020
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF
Source in vitro E.coli expression system
Gene Names DPM1
Protein Names Recommended name: Dolichol-phosphate mannosyltransferase EC= 2.4.1.83 Alternative name(s): Dolichol-phosphate mannose synthase Short name= DPM synthase Dolichyl-phosphate beta-D-mannosyltransferase Mannose-P-dolichol synthase Short name=
Expression Region 2-267
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families Glycosyltransferase 2 family
Database Links

KEGG: sce:YPR183W

STRING: 4932.YPR183W

Related Products

DPM1 Antibodies

DPM1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

DPM1 Proteins

DPM1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.