Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)

Code CSB-CF007134SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14020
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF
Source in vitro E.coli expression system
Gene Names DPM1
Protein Names Recommended name: Dolichol-phosphate mannosyltransferase EC= 2.4.1.83 Alternative name(s): Dolichol-phosphate mannose synthase Short name= DPM synthase Dolichyl-phosphate beta-D-mannosyltransferase Mannose-P-dolichol synthase Short name=
Expression Region 2-267
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families Glycosyltransferase 2 family
Database Links

KEGG: sce:YPR183W

STRING: 4932.YPR183W

Related Products

DPM1 Antibodies

DPM1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

DPM1 Proteins

DPM1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.