Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1(OST1)

Code CSB-CF020344SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41543
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence AQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN
Source in vitro E.coli expression system
Gene Names OST1
Protein Names Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 64 kDa subunit Oligosaccharyl transferase subunit OST1 Oligosaccharyl transferase subunit a
Expression Region 23-476
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families OST1 family
Database Links

KEGG: sce:YJL002C

STRING: 4932.YJL002C

Related Products

OST1 Antibodies

OST1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

OST1 Proteins

OST1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.