Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)

Code CSB-CF347193SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ERV29
Uniprot No.
Alternative Names
ERV29; YGR284C; ER-derived vesicles protein ERV29
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-310
Target Protein Sequence
MSYRGPIGNFGGMPMSSSQGPYSGGAQFRSNQNQSTSGILKQWKHSFEKFASRIEGLTDN AVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTV SMLIGASLLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSI VQNKTTFGMLPELNSKNDKAKGYLLFAGRILIVLMFIAFTFSKSWFTVVLTIIGTICFAI GYKTKFASIMLGLILTFYNITLNNYWFYNNTKRDFLKYEFYQNLSIIGGLLLVTNTGAGE LSVDEKKKIY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are solving topology of a membrane protein (5TM) now and want to know whether you have the capacity to express the protein. A pilot test will be performed first for an evaluation. We prefer to use baculovirus system in sf9 cells. Function is similar in yeast, human and all higher eukaryotes.
Target protein(s):
Attached is the sequence of the plasmid in the area of the Surf4 insert
Yeast sequence of homologous protein, ERV29, is P53337.1
We have fully functional Surf4 when we add a HA tag immediately after the starting methionine. I’d be hesitant to put anything longer there as this is one of those proteins where the amino terminus moves into the lumen of the ER without a leader sequence.
Unknown if functions as dimer or higher order but is found in dimers, trimers etc on western blots unless overnight incubation in LDS and 8M urea is used. We have binding assay but works to date only in native membrane preps, no binding yet when fully solubilized with n-Decyl-β-D-Maltopyranoside. May be in low affinity form when in DM or may not be folded correctly at all in this detergent.
Detailed plan is not necessary at this time, just a ball-park costs of various logical steps in your process. I have cDNA for human and yeast. If possible, could you please provide me an estimated cost and time for a pilot expression test of either/both of the proteins.

A:
Thanks for your inquiry,Yeast sequence of homologous protein, ERV29, is P53337.1
We also have corresponding product. This full-length protein is 5-time transmembrane protein. We also recommend cell-free expression system. The details and distributor price are as below.
Code: CSB-CF347193SVG
Name: Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29(ERV29)
You can view the product information on this page in details.
Uniprot Link: http://www.uniprot.org/uniprot/P53337
Lead Time: 25-35 working days

Target Background

Function
Constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi. The C-terminal di-lysine motif is required for exit from the endoplasmic reticulum. Required directly for packaging glycosylated pro-alpha-factor into COPII vesicles. Facilitates retrograde transport from the Golgi to the endoplasmic reticulum.
Gene References into Functions
  1. Erv29p contains four transmembrane domains with both termini exposed to the cytosol. Two luminal loops may contain a recognition site for hydrophobic export signals on soluble cargo PMID: 17520482
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
SURF4 family
Database Links

KEGG: sce:YGR284C

STRING: 4932.YGR284C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1