Recombinant Saccharomyces cerevisiae ER lumen protein retaining receptor(ERD2)

Code CSB-CF323017SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P18414
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MNPFRILGDLSHLTSILILIHNIKTTRYIEGISFKTQTLYALVFITRYLDLLTFHWVSLY NALMKIFFIVSTAYIVVLLQGSKRTNTIAYNEMLMHDTFKIQHLLIGSALMSVFFHHKFT FLELAWSFSVWLESVAILPQLYMLSKGGKTRSLTVHYIFAMGLYRALYIPNWIWRYSTED KKLDKIAFFAGLLQTLLYSDFFYIYYTKVIRGKGFKLPK
Source in vitro E.coli expression system
Gene Names ERD2
Protein Names Recommended name: ER lumen protein retaining receptor Alternative name(s): HDEL receptor
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor strongly recognizes H-D-E-L and weakly recognizes D-D-E-L and K-D-E-L.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family
Database Links

KEGG: sce:YBL040C

STRING: 4932.YBL040C

Related Products

ERD2 Antibodies

ERD2 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

ERD2 Proteins

ERD2 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.