Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 4(EMC4)

Code CSB-CF345646SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P53073
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH YNNGLQWFSD
Source in vitro E.coli expression system
Gene Names EMC4
Protein Names Recommended name: ER membrane protein complex subunit 4
Expression Region 1-190
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The EMC seems to be required for efficient folding of proteins in the endoplasmic reticulum (ER).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families EMC4 family
Database Links

KEGG: sce:YGL231C

STRING: 4932.YGL231C

Related Products

EMC4 Antibodies

EMC4 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

EMC4 Proteins

EMC4 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.