Recombinant Saccharomyces cerevisiae Glutathione transferase 3(GTT3)

Code CSB-CF340190SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P39996
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MPTKSTFSRWKKADLIDLANKLEIDGFPNYAKKSDMIDYLESHLNHLEKPVDFKDDYPEL RSFYESMTVDQSKDERNEYGSGSGNGSGSGSCDTATNDSDLEKAYIKEDDDEKPQSGDET SATKPLSSRNANSNAKTNFNLLDFSTDNDSSTSAFTKFKFNFQEYLSDIRYQTQKLNENV QDYLSTISAVDTIFSLLEFSFLVRNILAAGQPTSSSSLASSLEAAVAAHNKYQYTLDFCL PILTWLLFFRGIPTLVSYYINFIRYDLNIELDPMTFNLTKFLISLAIFKTCNNKNIDFHS FRCVNQLWTQLCTVNRSLGMVPLVFSMVSCLLTLYVL
Source in vitro E.coli expression system
Gene Names GTT3
Protein Names Recommended name: Glutathione transferase 3
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Nucleus membrane, Multi-pass membrane protein
Database Links

KEGG: sce:YEL017W

STRING: 4932.YEL017W

Related Products

GTT3 Antibodies

GTT3 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

GTT3 Proteins

GTT3 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.