Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23)

Code CSB-CF023553SVG
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TIM23
Uniprot No.
Alternative Names
TIM23; MAS6; MIM23; MPI3; YNR017W; N3180; Mitochondrial import inner membrane translocase subunit TIM23; Membrane import machinery protein MIM23; Mitochondrial protein import protein 3; Mitochondrial protein import protein MAS6
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-222
Target Protein Sequence
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Gene References into Functions
  1. Cation selectivity of Tim23 is crucial for efficient protein import. PMID: 28857742
  2. reduced phosphatidylcholine levels differentially affect the TIM22 and TIM23 complexes in mitochondrial protein transport PMID: 27402832
  3. Tim23 contains multiple sites to interact with the intermembrane space domain of Tim21 and to bind to Tim21, Tim50, and Tom22.A central role of the intermembrane space domain of Tim23 in the formation and regulation of the presequence translocase. PMID: 25263020
  4. Modulating the sorting of nuclear-encoded proteins into mitochondria, mediated by the TIM23 complex, proves therapeutic in both yeast and patient-derived cells exhibiting ATP synthase deficiency. PMID: 25519239
  5. The GxxxG motifs found in the first and second transmembrane segments of Tim23 are necessary for the structural integrity of the TIM23 complex. PMID: 25765297
  6. IMS domain of Tim23 tightly associates with both inner and outer mitochondrial membrane-like membranes through a hydrophobic anchor at its N terminus PMID: 25349212
  7. Data propose that Mgr2 functions at the checkpoint for lateral sorting of the TIM23 complex in mitochondria. PMID: 25454944
  8. the mitochondrial ADP/ATP carrier associates with the membrane-embedded core of the TIM23 complex in a stoichiometric manner PMID: 25124039
  9. TIM23 transmembrane helix 2 is involved in the recruitment of Tim21 and the presequence-associated motor (PAM) subcomplex to the Tim23 channel. PMID: 24061477
  10. Changes in the energized state of the mitochondrial inner membrane cause marked structural alterations in the Tim23 channel region. PMID: 23832274
  11. analysis of the threshold hydrophobicity for TIM23-mediated insertion in the inner mitochondrial membrane PMID: 23283966
  12. analyses have revealed a novel transport mechanism for a polytopic membrane protein in which internal signals direct the precursor into the inner membrane via the TIM23 complex, indicating a presequence-independent function of this translocase PMID: 23045398
  13. analysis of interaction of mitochondrial targeting presequences with purified components of the TIM23 protein complex PMID: 21969381
  14. The beta-hairpin is crucial for the interaction of Tim50 with Tim23, suggesting a cooperative function of these two essential TIM proteins in preprotein import. PMID: 21704637
  15. The authors find that hydrophobicity and the location of polar and aromatic residues are strong determinants of membrane insertion mediated by TIM23. PMID: 21326212
  16. By using NMR spectroscopy, we show that Tim23N is a monomeric protein belonging to the family of intrinsically disordered proteins. Titrations of Tim23N with two presequences revealed a distinct binding region of Tim23N formed by residues 71-84. PMID: 20718036
  17. Tim23p acts as receptor for preproteins and may largely constitute the preprotein-conducting passageway of preprotein translocase. PMID: 17148445
  18. Study showed that the protein transport in mutant TIM23 mitochondria was strongly impaired. PMID: 17828250
  19. These structural changes reveal that the macromolecular arrangement within the TIM23 complex is dynamic and varies with the physiological state of the mitochondrion. PMID: 17959826
  20. TIM23 complex acts as a single structural and functional entity that is actively remodelled to sort preproteins into different mitochondrial subcompartments. PMID: 18418384
  21. Probes on the aqueous-facing helical surface of TIM23 specifically underwent spectral changes during protein import. PMID: 18692467
  22. Interaction of Tim23 with Tim50 Is essential for protein translocation by the mitochondrial TIM23 complex. PMID: 19017642

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Around 20 amino acids of the N-terminus are believed to span the mitochondrial outer membrane. This association is dynamic and depends on the translocation activity of the TIM23 complex. However, this topology seems not to be critical for formation of a TOM-TIM supercomplex and preprotein import.
Protein Families
Tim17/Tim22/Tim23 family
Database Links

KEGG: sce:YNR017W

STRING: 4932.YNR017W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1