Recombinant Saccharomyces cerevisiae Protein DFG16(DFG16)

Code CSB-CF859499SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99234
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MIIRLHFYYLLTLVYHLGLVGAYEKAARKRIQPPDLIPGPPGHKLGDERPPHYDHRPPYK KHIDNIPAYNLTDLIDDKLLNKYENSCTVNVLTGGFISLASNSWHLRAYNYTLNYPSFLI RCDNGSANPNFSHVLQDFVYDINNKFNVQDDSSKYIGKDPFPLGMIMITFASGCICVATW MLFLVVLLLPSDNHNRRNKVVHVYVLFSAIIRTVFLNETIAVIFDSQYHDDYQDASQFES FIVETAPYKICELVANILSDINWIYIVHYLQSNYGKPTWNWIPFKMKKGTHIIITVGCFL SLADNILFANLLWRKNLVVLKVFYKLIELLIYTIFISIICYFTWHNFAYILLPKTAEINT DGKCKTKLRILWENYHETIPLLAYNILIFILFYFTTIFFAAFTKHVRGWTFNFVHLLKVL ITVNVWGLIGVLEKRELHISKKTVLGRKINNRDKFFANPTVNYYGEDLGKHLSAITLNRD LNTTKSNTTSHDSSSLVGSPSPTWKSPIERIRDRRRRHKIMKSENKFGQNPSFGSKSNGK PNTKTTLSKYRQLLRKPRRKTNSYEPKNGIGQNKEGSTVRPGADKHIRDSNYLATDISDN ESMETELRTNHIYNYENSD
Source in vitro E.coli expression system
Gene Names DFG16
Protein Names Recommended name: Protein DFG16 Alternative name(s): Extracellular mutant protein 41 Zinc-regulated gene 11 protein
Expression Region 1-619
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in invasion during filamentous growth.
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: sce:YOR030W

STRING: 4932.YOR030W

Related Products

DFG16 Antibodies

DFG16 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

DFG16 Proteins

DFG16 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.