Recombinant Saccharomyces cerevisiae Protein DFG16(DFG16)

Code CSB-CF859499SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99234
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MIIRLHFYYLLTLVYHLGLVGAYEKAARKRIQPPDLIPGPPGHKLGDERPPHYDHRPPYK KHIDNIPAYNLTDLIDDKLLNKYENSCTVNVLTGGFISLASNSWHLRAYNYTLNYPSFLI RCDNGSANPNFSHVLQDFVYDINNKFNVQDDSSKYIGKDPFPLGMIMITFASGCICVATW MLFLVVLLLPSDNHNRRNKVVHVYVLFSAIIRTVFLNETIAVIFDSQYHDDYQDASQFES FIVETAPYKICELVANILSDINWIYIVHYLQSNYGKPTWNWIPFKMKKGTHIIITVGCFL SLADNILFANLLWRKNLVVLKVFYKLIELLIYTIFISIICYFTWHNFAYILLPKTAEINT DGKCKTKLRILWENYHETIPLLAYNILIFILFYFTTIFFAAFTKHVRGWTFNFVHLLKVL ITVNVWGLIGVLEKRELHISKKTVLGRKINNRDKFFANPTVNYYGEDLGKHLSAITLNRD LNTTKSNTTSHDSSSLVGSPSPTWKSPIERIRDRRRRHKIMKSENKFGQNPSFGSKSNGK PNTKTTLSKYRQLLRKPRRKTNSYEPKNGIGQNKEGSTVRPGADKHIRDSNYLATDISDN ESMETELRTNHIYNYENSD
Source in vitro E.coli expression system
Gene Names DFG16
Protein Names Recommended name: Protein DFG16 Alternative name(s): Extracellular mutant protein 41 Zinc-regulated gene 11 protein
Expression Region 1-619
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in invasion during filamentous growth.
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: sce:YOR030W

STRING: 4932.YOR030W

Related Products

DFG16 Antibodies

DFG16 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

DFG16 Proteins

DFG16 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.