Recombinant Saccharomyces cerevisiae Protein ECM34(ECM34)

Code CSB-CF327879SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P38728
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MEGRKSEDEKNEAALACDVFESSNAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLI VGWKVFSGIGGRRPSDSNMDGPQTKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRE RTFGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYENKLWNTEYFFC
Source in vitro E.coli expression system
Gene Names ECM34
Protein Names Recommended name: Protein ECM34 Alternative name(s): Extracellular mutant protein 34
Expression Region 1-170
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in cell wall organization and biogenesis.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families DUP/COS family
Database Links

KEGG: sce:YHL043W

STRING: 4932.YHL043W

Related Products

ECM34 Antibodies

ECM34 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

ECM34 Proteins

ECM34 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.