Recombinant Saccharomyces cerevisiae Protein RTA1(RTA1)

Code CSB-CF347375SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P53047
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MAKDGFELYRYTPELGASILFTVLFAVSGVAFVILLFHYSVKSKRRVGSLMKSQPVLRYY GTVNLAGAYIPFIFGCFVECVGFAFRCKSSKDTTLLNPYIIQTVFLLVSPTLYAASIYMI FGRMATLLFAENLMIMPARFNTTIFVIGDVGSLLLQAIGGAMMSKVTSASSGSHLVTAGL FIQIAFFGLFIINEVLFIFKMSKKPTNVSVRYGSWKYLNIALLVNSFLILIRSIVRAVEF IQGYDGEIASHEWYLYIFDGLPMFLLVLIFIVAFPLINIFRIHEESIQAQQSARFDGTDY PDVEVTSIEEDLASKSE
Source in vitro E.coli expression system
Gene Names RTA1
Protein Names Recommended name: Protein RTA1
Expression Region 1-317
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in 7-aminocholesterol resistance.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Lipid-translocating exporter (LTE) (TC 9.A.26.1) family
Database Links

KEGG: sce:YGR213C

STRING: 4932.YGR213C

Related Products

RTA1 Antibodies

RTA1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

RTA1 Proteins

RTA1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.