Recombinant Saccharomyces cerevisiae Protein RTC2(RTC2)

Code CSB-CF336429SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P38279
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MKLIPIILNAKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFN VMGAMMQNLLPTMIILAAYYTLADLILLIQCMWYDKEKKSILQEVKKNVDPVHLPPANPI NETVLQDVFNEYEPLLPRIEEEDSQSYSSLELGRTIVVKERENFFNDFLIVSGVLIAGIL SWYISYCSGLDNGIPKKKPAFEQINLPAQILGYLSAILYLGSRIPQIVLNFKRKSCEGVS FLFFLFACLGNTSFIISVLSASWLIGSAGTLLMDFTVFIQFFLYAKPKYEKILIDN
Source in vitro E.coli expression system
Gene Names RTC2
Protein Names Recommended name: Protein RTC2 Alternative name(s): Restriction of telomere capping protein 2
Expression Region 1-296
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as an amino acid transporter mediating the export of cationic amino acids from the vacuole. Required for optimal growth in synthetic medium.
Subcellular Location Vacuole membrane, Multi-pass membrane protein, Mitochondrion membrane, Multi-pass membrane protein
Protein Families Laat-1 family
Database Links

KEGG: sce:YBR147W

STRING: 4932.YBR147W

Related Products

RTC2 Antibodies

RTC2 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

RTC2 Proteins

RTC2 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.