Recombinant Saccharomyces cerevisiae Protein RTM1(RTM1)

Code CSB-CF331129SAC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P40113
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (Baker's yeast)
Sequence MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSLQVVWDARKASKPEVDNPFDTPV DKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQ AVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGL MATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTL MLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTT ITECQSLKP
Source in vitro E.coli expression system
Gene Names RTM1
Protein Names Recommended name: Protein RTM1
Expression Region 1-309
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Confers resistance to molasses (to a particular toxic element present in some molasses).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Lipid-translocating exporter (LTE) (TC 9.A.26.1) family

Related Products

RTM1 Antibodies

RTM1 Antibodies for Saccharomyces cerevisiae (Baker's yeast)

RTM1 Proteins

RTM1 Proteins for Saccharomyces cerevisiae (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.