Recombinant Saccharomyces cerevisiae Protein SFK1(SFK1)

Code CSB-CF336074SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P35735
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MIQFKSPGNWLFIVPWIAFIPWYGMLIAMLICWASQGHPIYWFMHSEQFPVYISDIGATN LRPLFISCAGWQGLGYVITVALEFFQRSGYLPFQLKKKDPSISDSTSYAEKLHSGKYLMP PYYTKDERNLIFAAFVLGSIGELALLFSSIFSTALYHRVHIAMVSVFVVFMFLSTCCLIA EYFLMGRHYASVHPLASPHFNPQSSEKSFNQDYNTVDELPWYKWKGHVWNKFTISATLKV IWLTLAVVWAICFGAINDRSKSACFEWLLAFWFGIIFMILSADFYLGGRYRQSRYFNHVE SFSGYYKYDKALGLYHSEDVLPSDDNAGVIATETASSNIYNNSSSNESIQVVV
Source in vitro E.coli expression system
Gene Names SFK1
Protein Names Recommended name: Protein SFK1 Alternative name(s): Suppressor of four kinase protein 1
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May control the production of phosphatidylinositol 4-phosphate (PI4P) by the STT4 PI 4-kinase. Mediates proper localization of STT4 to the plasma membrane.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SFK1 family
Database Links

KEGG: sce:YKL051W

STRING: 4932.YKL051W

Related Products

SFK1 Antibodies

SFK1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

SFK1 Proteins

SFK1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.