Recombinant Saccharomyces cerevisiae Putative uncharacterized protein OPI9(OPI9)

Code CSB-CF529630SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O94084
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MFFESRPIVGVGGGGGACGGLLTCVGRDAEGKGGADTLGREILELFLWWLLCAGLTEGIC GLFCGTFGAEAPDNGSGGAGDDGTMGIGGAAEDGISGIGGAEDEGILGTAGAGDNGALGM GGAATDGTAPGIGGALADGEGLVLALLLICFNFGIPPAKISPNCGAPIPGIGGADIEGPL LLTVPELPEADETTPPPTIGALLSLVSAFFSFIPFLMSPNRASRPCITDFAGLGALPPNA GGGGGGGGAGAPAISTIRYIYGRLLQQTVVRFLVVCFVSYQKLSS
Source in vitro E.coli expression system
Gene Names OPI9
Protein Names Recommended name: Putative uncharacterized protein OPI9
Expression Region 1-285
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

STRING: 4932.YLR338W

Related Products

OPI9 Antibodies

OPI9 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

OPI9 Proteins

OPI9 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.