Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL149W (YGL149W)

Code CSB-CF344851SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P53116
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence GSVVTLLLLLFFCLFLLFFSLHFFCFTREHVHYTLPPKCHSLKFQFDSIPSSSLSLSPFP FLFFPRLRAVAFASPTLSFFFPI
Source in vitro E.coli expression system
Gene Names YGL149W
Protein Names Recommended name: Putative uncharacterized protein YGL149W
Expression Region 19-101
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

STRING: 4932.YGL149W

Related Products

YGL149W Antibodies

YGL149W Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

YGL149W Proteins

YGL149W Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.