Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL149W (YGL149W)

Code CSB-CF344851SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P53116
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence GSVVTLLLLLFFCLFLLFFSLHFFCFTREHVHYTLPPKCHSLKFQFDSIPSSSLSLSPFP FLFFPRLRAVAFASPTLSFFFPI
Source in vitro E.coli expression system
Gene Names YGL149W
Protein Names Recommended name: Putative uncharacterized protein YGL149W
Expression Region 19-101
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

STRING: 4932.YGL149W

Related Products

YGL149W Antibodies

YGL149W Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

YGL149W Proteins

YGL149W Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.