Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR115C (YGR115C)

Code CSB-CF347398SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P53269
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MSYISSILSDDRPVICVGCLMDCSLKSFFSWILLCLVSSSSSENSSSSMKSSNSSKIPPL SAVLFLFSWSSSSRPYSLFLPLRKPDSSSSSSSEKKSSNLDVESCLDAATLSLSDSAAFP SSPTLFNLLNFPEEELALVRSTPAFSINKSKSSSDSRSSSSLSLLLCFLLFLEILVPGSS FSSSSLTMKPSCTFLASSSSSSISSSSSEESKTSSPSSSSLGALVSSLSFTISSSSLGTS FESPVSSIKGKFYVKILGN
Source in vitro E.coli expression system
Gene Names YGR115C
Protein Names Recommended name: Putative uncharacterized protein YGR115C
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein

Related Products

YGR115C Antibodies

YGR115C Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

YGR115C Proteins

YGR115C Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.