Recombinant Saccharomyces cerevisiae Sphingosine N-acyltransferase LAC1(LAC1)

Code CSB-CF408171STA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6ZZV7
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Sequence MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAAKRRMQRLSEA TKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFTSGNTTKTNVLHRFVAVSYQI GDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAI FYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVL QLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVL IGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEESDESSTTPTDSTPTKKDI
Source in vitro E.coli expression system
Gene Names LAC1
Protein Names Recommended name: Sphingosine N-acyltransferase LAC1 EC= 2.3.1.24
Expression Region 1-418
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Redundant with LAG1. Facilitates ER-to-Golgi transport of GPI-anchored proteins (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Sphingosine N-acyltransferase family

Related Products

LAC1 Antibodies

LAC1 Antibodies for Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

LAC1 Proteins

LAC1 Proteins for Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.