Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c'(VMA16)

Code CSB-CF338558SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23968
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWA NLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIV FSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL FVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ
Source in vitro E.coli expression system
Gene Names VMA16
Protein Names Recommended name: V-type proton ATPase subunit c'' Short name= V-ATPase subunit c'' Alternative name(s): V-ATPase 22 kDa proteolipid subunit Vacuolar proton pump c'' subunit
Expression Region 1-213
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families V-ATPase proteolipid subunit family
Database Links

KEGG: sce:YHR026W

STRING: 4932.YHR026W

Related Products

VMA16 Antibodies

VMA16 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.