Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin

Code CSB-CF355678SAD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P01546
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)
Sequence YVYPMCEHGIKASYCMALNDAMVSANGNLYGLAEKLFSEDEGQWETNYYKLYWSTGQWIM SMKFIEESIDNANNDFEGCDTGH
Source in vitro E.coli expression system
Protein Names Recommended name: M1-1 protoxin Alternative name(s): Killer toxin K1 Cleaved into the following 4 chains: 1. M1-1 delta chain 2. M1-1 alpha chain 3. M1-1 gamma immunity chain 4. M1-1 beta chain
Expression Region 234-316
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ionophoric toxin secreted by an infected host and lethal to non-infected sensitive strains. Cell killing is achieved in a receptor-mediated process, requiring initial toxin binding to a cell wall (1->6)-beta-D-glucan and, probably, subsequent transfer to a plasma membrane receptor. K1 toxin disrupts the cell by creating a pore across the target cell membrane.
Subcellular Location Secreted, Host membrane, Multi-pass membrane protein
Database Links

KEGG: vg:1494398

Related Products

Antibodies

Antibodies for Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)

Proteins

Proteins for Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.