Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin

Code CSB-CF355678SAD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P01546
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)
Sequence YVYPMCEHGIKASYCMALNDAMVSANGNLYGLAEKLFSEDEGQWETNYYKLYWSTGQWIM SMKFIEESIDNANNDFEGCDTGH
Source in vitro E.coli expression system
Protein Names Recommended name: M1-1 protoxin Alternative name(s): Killer toxin K1 Cleaved into the following 4 chains: 1. M1-1 delta chain 2. M1-1 alpha chain 3. M1-1 gamma immunity chain 4. M1-1 beta chain
Expression Region 234-316
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ionophoric toxin secreted by an infected host and lethal to non-infected sensitive strains. Cell killing is achieved in a receptor-mediated process, requiring initial toxin binding to a cell wall (1->6)-beta-D-glucan and, probably, subsequent transfer to a plasma membrane receptor. K1 toxin disrupts the cell by creating a pore across the target cell membrane.
Subcellular Location Secreted, Host membrane, Multi-pass membrane protein
Database Links

KEGG: vg:1494398

Related Products

Antibodies

Antibodies for Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)

Proteins

Proteins for Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.