Recombinant Salmonella typhimurium Glycine betaine/L-proline transport system permease protein proW(proW)

Code CSB-CF325494SXB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P17327
Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Sequence MADQTNPWDTAQVADTTTQTADAWGTPAGVATDGGSTDWLNSAPAPAPEHFSLLDPFHKT LIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILFALIAWQV SGVGMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLARSPRAAKIV RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPADLIEA SRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR LDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYTTGPVGLITRPFVK
Source in vitro E.coli expression system
Gene Names proW
Protein Names Recommended name: Glycine betaine/L-proline transport system permease protein proW
Expression Region 1-354
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ProU ABC transporter complex involved in glycine betaine and proline betaine uptake. Probably responsible for the translocation of the substrate across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family, CysTW subfamily
Database Links

KEGG: stm:STM2810

STRING: 99287.STM2810

Related Products

proW Antibodies

proW Antibodies for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

proW Proteins

proW Proteins for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.