Recombinant Schizosaccharomyces pombe GTPase-activating protein gyp10(gyp10)

Code CSB-CF528489SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O94661
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MKKKEIKQLKNEIKIALLNSDVETLSHIGKEGHGFLMKSLRKSVWVSLCGLSCRHRMECL SRSTSQSSYADQNQVHLDSERSFFQYKLNPFLLRKHRSQLTKLLSVVFKHYPELCYYQGL HDIAQILLLTLPFSHALPLMEHLVFYRLRDFMLPTLDGTVKQLQLILAVIKARDPTLYEY LIKADIQCYFALSWLITWFAHDVSDISVVCRLFDFFISSHPLTVVYTCAQVVLDNRTSII ELLWDNSGADLLHSYLCKLPASINVNQLIKNTCATISAVPFSSLPLDRYQISPYSCLRNT GDPWEYMSRSNGLLLFRLQLAELQEEKHKPGTKVPAVFLQENIFNGCNMLAAITVIGIGI VASQLIPKSTSNS
Source in vitro E.coli expression system
Gene Names gyp10
Protein Names Recommended name: GTPase-activating protein gyp10
Expression Region 1-373
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in vesicular trafficking and septation during cytokinesis.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Database Links

KEGG: spo:SPBC651.03c

STRING: 4896.SPBC651.03c.1

Related Products

gyp10 Antibodies

gyp10 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

gyp10 Proteins

gyp10 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.