Recombinant Schizosaccharomyces pombe Gamma-glutamyltranspeptidase 2(ggt2)

Code CSB-CF009395SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O14194
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MSPTDTTPLLYSWDDQSRHQDPDWHKLRNYHGAWYRRISRRRFSQFIFAFGLMTLFVLVYSISSNLHTPTQFTGHKVRGRRGAVASEVPVCSDIGVSMLADGGNAVDAAIASTFCIGVVNFFSSGIGGGGFMLIKHPNETAQSLTFREIAPGNVSKHMFDKNPMLAQVGPLSIAIPGELAGLYEAWKSHGLLDWSKLLEPNVKLAREGFPVTRAMERVLKLPEMAHLLKDPIWQPILMPNGKVLRAGDKMFRPAYAKTLEIIANKGIEPFYRGELTNSMVKFIQDNGGIVTVEDFGNYSTVFADALHTSYRGHDVYTCTLPTSGPALIEGLNILDGYPLNTPSLAFPKRLHLEVEAMKWLSAGRTQFGDPDFLPLDHLDVVSKLLSKEFASQIRNNISLSKTYPWEHYNPSYDLPISHG
Source in vitro E.coli expression system
Gene Names ggt2
Protein Names Recommended name: Gamma-glutamyltranspeptidase 2 EC= 2.3.2.2 Alternative name(s): Gamma-glutamyltransferase 2 Glutathione hydrolase 2 EC= 3.4.19.13 Cleaved into the following 2 chains: 1. Gamma-glutamyltranspeptidase 2 heavy chain 2. Gamma
Expression Region 1-419
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of the gamma-glutamyl moiety of glutathione (GSH) and other gamma-glutamyl compounds to amino acids and peptides. Major GSH-degrading enzyme, catalyzing the hydrolytic release of L-glutamate from GSH. Plays a role in the turnover of the vacuolar GSH, serving as an alternative nitrogen source during nitrogen starvation (By similarity).
Subcellular Location Vacuole membrane, Single-pass type II membrane protein
Protein Families Gamma-glutamyltransferase family
Database Links

KEGG: spo:SPAC56E4.06c

STRING: 4896.SPAC56E4.06c.1

Related Products

ggt2 Antibodies

ggt2 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

ggt2 Proteins

ggt2 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.