Recombinant Schizosaccharomyces pombe Gamma-glutamyltranspeptidase 2(ggt2)

Code CSB-CF009395SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O14194
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MSPTDTTPLLYSWDDQSRHQDPDWHKLRNYHGAWYRRISRRRFSQFIFAFGLMTLFVLVYSISSNLHTPTQFTGHKVRGRRGAVASEVPVCSDIGVSMLADGGNAVDAAIASTFCIGVVNFFSSGIGGGGFMLIKHPNETAQSLTFREIAPGNVSKHMFDKNPMLAQVGPLSIAIPGELAGLYEAWKSHGLLDWSKLLEPNVKLAREGFPVTRAMERVLKLPEMAHLLKDPIWQPILMPNGKVLRAGDKMFRPAYAKTLEIIANKGIEPFYRGELTNSMVKFIQDNGGIVTVEDFGNYSTVFADALHTSYRGHDVYTCTLPTSGPALIEGLNILDGYPLNTPSLAFPKRLHLEVEAMKWLSAGRTQFGDPDFLPLDHLDVVSKLLSKEFASQIRNNISLSKTYPWEHYNPSYDLPISHG
Source in vitro E.coli expression system
Gene Names ggt2
Protein Names Recommended name: Gamma-glutamyltranspeptidase 2 EC= 2.3.2.2 Alternative name(s): Gamma-glutamyltransferase 2 Glutathione hydrolase 2 EC= 3.4.19.13 Cleaved into the following 2 chains: 1. Gamma-glutamyltranspeptidase 2 heavy chain 2. Gamma
Expression Region 1-419
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of the gamma-glutamyl moiety of glutathione (GSH) and other gamma-glutamyl compounds to amino acids and peptides. Major GSH-degrading enzyme, catalyzing the hydrolytic release of L-glutamate from GSH. Plays a role in the turnover of the vacuolar GSH, serving as an alternative nitrogen source during nitrogen starvation (By similarity).
Subcellular Location Vacuole membrane, Single-pass type II membrane protein
Protein Families Gamma-glutamyltransferase family
Database Links

KEGG: spo:SPAC56E4.06c

STRING: 4896.SPAC56E4.06c.1

Related Products

ggt2 Antibodies

ggt2 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

ggt2 Proteins

ggt2 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.