Recombinant Schizosaccharomyces pombe Inositol phoshorylceramide synthase regulatory subunit kei1(kei1)

Code CSB-CF519337SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O13994
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MALFRRPNWSALFEKIFIQKSFLGFCSLRVGCEIIIWFAIINKVSGLYGIVSLFQNSDAS PWQVLMYVSSVLMLILFSWLAIHIPKSSVPHALILFYVYLIDFLLNVLFTVLFALSWFSK LVQSDSSSTEESADSDPSPSLLYLFFQAESIPSLLLLIFFASLKFYFVLITLSYSNKLIV DSGIRPQNLPPNFSGRVTRLLMKPYIMAANRSYLRNHTKRFTDSIELEQRLMDEVV
Source in vitro E.coli expression system
Gene Names kei1
Protein Names Recommended name: Inositol phoshorylceramide synthase regulatory subunit kei1 Short name= ICP synthase regulatory subunit kei1
Expression Region 1-236
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulatory component of the inositol phosphorylceramide (ICP) synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis. Helps the medial Golgi localization of IPC synthase in a COPI vesicle-dependent manner (By similarity).
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families KEI1 family
Database Links

KEGG: spo:SPAC26H5.13c

STRING: 4896.SPAC26H5.13c.1

Related Products

kei1 Antibodies

kei1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

kei1 Proteins

kei1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.