Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor(mam2)

Code CSB-CF311474SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q00619
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MRQPWWKDFTIPDASAIIHQNITIVSIVGEIEVPVSTIDAYERDRLLTGMTLSAQLALGV LTILMVCLLSSSEKRKHPVFVFNSASIVAMCLRAILNIVTICSNSYSILVNYGFILNMVH MYVHVFNILILLLAPVIIFTAEMSMMIQVRIICAHDRKTQRIMTVISACLTVLVLAFWIT NMCQQIQYLLWLTPLSSKTIVGYSWPYFIAKILFAFSIIFHSGVFSYKLFRAILIRKKIG QFPFGPMQCILVISCQCLIVPATFTIIDSFIHTYDGFSSMTQCLLIISLPLSSLWASSTA LKLQSMKTSSAQGETTEVSIRVDRTFDIKHTPSDDYSISDESETKKWT
Source in vitro E.coli expression system
Gene Names mam2
Protein Names Recommended name: Pheromone P-factor receptor
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the peptide pheromone P-factor, a mating factor of S.pombe. Pheromone signaling is essential for initiation of meiosis in S.pombe; P-factor signaling alone may be sufficient.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 4 family
Database Links

KEGG: spo:SPAC11H11.04

STRING: 4896.SPAC11H11.04.1

Related Products

mam2 Antibodies

mam2 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

mam2 Proteins

mam2 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.