Recombinant Schizosaccharomyces pombe Pheromone P-factor receptor(mam2)

Code CSB-CF311474SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q00619
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MRQPWWKDFTIPDASAIIHQNITIVSIVGEIEVPVSTIDAYERDRLLTGMTLSAQLALGV LTILMVCLLSSSEKRKHPVFVFNSASIVAMCLRAILNIVTICSNSYSILVNYGFILNMVH MYVHVFNILILLLAPVIIFTAEMSMMIQVRIICAHDRKTQRIMTVISACLTVLVLAFWIT NMCQQIQYLLWLTPLSSKTIVGYSWPYFIAKILFAFSIIFHSGVFSYKLFRAILIRKKIG QFPFGPMQCILVISCQCLIVPATFTIIDSFIHTYDGFSSMTQCLLIISLPLSSLWASSTA LKLQSMKTSSAQGETTEVSIRVDRTFDIKHTPSDDYSISDESETKKWT
Source in vitro E.coli expression system
Gene Names mam2
Protein Names Recommended name: Pheromone P-factor receptor
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the peptide pheromone P-factor, a mating factor of S.pombe. Pheromone signaling is essential for initiation of meiosis in S.pombe; P-factor signaling alone may be sufficient.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 4 family
Database Links

KEGG: spo:SPAC11H11.04

STRING: 4896.SPAC11H11.04.1

Related Products

mam2 Antibodies

mam2 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

mam2 Proteins

mam2 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.